BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0266 (331 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) 29 0.69 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 29 0.69 SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 27 2.8 SB_27810| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.8 SB_29980| Best HMM Match : E-MAP-115 (HMM E-Value=1.3) 27 3.7 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.5 SB_32123| Best HMM Match : Keratin_B2 (HMM E-Value=0.019) 26 6.5 SB_4303| Best HMM Match : Defensin_beta (HMM E-Value=0.85) 26 6.5 >SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) Length = 283 Score = 29.5 bits (63), Expect = 0.69 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 119 GFEENLMRNWVCLVEHESSRDTSKTN 196 GFEE + R W+ + E S D +KTN Sbjct: 33 GFEEEVKRQWIGCDKLEGSNDITKTN 58 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 29.5 bits (63), Expect = 0.69 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 112 ETWLRRKSHEELGMSGRAREQP*HVQDEHEP-*RLEG-LRIXPDQ-RPXXXXKGASPXK 279 E WL RK H E +S RE+ V+++H+P + + ++ DQ RP K SP + Sbjct: 223 EAWLERKEHREDSLSEHEREE---VKNKHKPMIKADATYKVKSDQARPNHERKQRSPER 278 >SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1145 Score = 27.5 bits (58), Expect = 2.8 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 186 DVSRLLSCSTRHTQFLMRFSSK-PCFL--SSCTRXHLVNVLASEPTQRTTKAKIINFCIS 16 D + C++ Q L+ K PC SC + + +V A E Q TT AK ++ C S Sbjct: 98 DQRKAKCCNSGEHQSLISEDEKLPCLSVKKSCFKEGIASVPAKETDQVTTTAKDVSDCCS 157 >SB_27810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 101 HELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSK 217 H RKH F N+ R+ + HE+ ++ K + R +K Sbjct: 61 HRRRKHIFRHNVRRSGISGESHENRKNKKKEHKKRMHAK 99 >SB_29980| Best HMM Match : E-MAP-115 (HMM E-Value=1.3) Length = 215 Score = 27.1 bits (57), Expect = 3.7 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 112 ETWLRRKSHEELGMSGRAREQP*HVQDEHEP*RLEGLR 225 E W+RRK E L RAR + +E R E LR Sbjct: 162 EEWMRRKDQEALEREERARREAEQKYEEKRKRREEVLR 199 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -2 Query: 183 VSRLLSCSTRHTQFLMRFSS-KPCF 112 V + LSC RHT +++ SS +PC+ Sbjct: 157 VMQTLSCRPRHTDLVIQTSSYRPCY 181 >SB_32123| Best HMM Match : Keratin_B2 (HMM E-Value=0.019) Length = 1097 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -2 Query: 183 VSRLLSCSTRHTQFLMRFSS-KPCF 112 V + LSC RHT +++ SS +PC+ Sbjct: 51 VMQTLSCRPRHTDLVIQTSSYRPCY 75 >SB_4303| Best HMM Match : Defensin_beta (HMM E-Value=0.85) Length = 203 Score = 26.2 bits (55), Expect = 6.5 Identities = 15/63 (23%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -2 Query: 183 VSRLLSCSTRHTQFLMRFSSKPCFLSS--CTRXHLVNVLASEPTQRTTKAKIINFCISIV 10 VS CSTRHT+ ++ ++ S C H N+++ T ++I C++ + Sbjct: 19 VSHPYCCSTRHTRLIVTCITRINMSHSHCCVTCHSRNIVSHPYCCSTRHTRVIVTCLTRI 78 Query: 9 SFA 1 + + Sbjct: 79 NMS 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,996,441 Number of Sequences: 59808 Number of extensions: 135057 Number of successful extensions: 288 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 463065397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -