BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0262 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81083-4|CAB03102.1| 645|Caenorhabditis elegans Hypothetical pr... 28 6.3 Z93387-5|CAB54299.3| 134|Caenorhabditis elegans Hypothetical pr... 28 8.3 >Z81083-4|CAB03102.1| 645|Caenorhabditis elegans Hypothetical protein F44F1.5 protein. Length = 645 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 320 LVYAVSLHSSAPGTRYSHCIRCAARTHYNHNRNSRT 213 L+ S+HS TR HC C + + + NS T Sbjct: 263 LIPKYSVHSKVLDTRVIHCFNCLSEKNEQYTYNSAT 298 >Z93387-5|CAB54299.3| 134|Caenorhabditis elegans Hypothetical protein T02E9.5 protein. Length = 134 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 345 ECTIRRQRPFPGLVASYAPXEGQIACSTQWSGCSD 449 + T+R + F G +A YAP G I CS Q++ C D Sbjct: 25 DATVRDKTEFCGTMAQYAP-TGDIYCS-QFAMCCD 57 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,385,443 Number of Sequences: 27780 Number of extensions: 250788 Number of successful extensions: 547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -