BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0259 (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.8 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 23 3.1 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 9.5 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.8 bits (49), Expect = 1.8 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 216 PSPYGYTAQAPSP-----PPTTGTACRTPPPASSGGTSLPTETGALPHT 347 PSP A APS PP G A P +GG + E L T Sbjct: 511 PSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQELKRLKST 559 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 762 CRKNKNHQAFYRNQXTKXFEG 700 CR N +A+YR K +G Sbjct: 43 CRNNGEEEAYYRKHLLKDADG 63 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 508 IILNIYGGSTFYVCSRYI 561 I+L G FY+ SRY+ Sbjct: 336 IVLGAIGSIVFYIISRYV 353 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 3.1 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 PPQ P +PS + PASS +S PT + P ++ + P Sbjct: 565 PPQ-CPRFRKLDSPSDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKEVEDMP 619 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 261 TTGTACRTPPPASSGGTSLPTETGAL 338 TT A TPP G T GAL Sbjct: 46 TTAAATPTPPSVPVGSAVAGTAGGAL 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,083 Number of Sequences: 438 Number of extensions: 4773 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -