BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0259 (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 47 2e-05 At3g11130.1 68416.m01349 clathrin heavy chain, putative similar ... 45 5e-05 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 42 6e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 40 0.002 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 40 0.002 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 40 0.002 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 40 0.002 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 39 0.003 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 39 0.004 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 39 0.004 At3g24550.1 68416.m03083 protein kinase family protein contains ... 39 0.004 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 39 0.004 At1g61080.1 68414.m06877 proline-rich family protein 38 0.006 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 38 0.007 At5g38560.1 68418.m04662 protein kinase family protein contains ... 38 0.010 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 37 0.013 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 37 0.013 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 36 0.022 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.022 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.022 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 36 0.030 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 36 0.030 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 36 0.039 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 36 0.039 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.039 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 36 0.039 At1g26150.1 68414.m03192 protein kinase family protein similar t... 36 0.039 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 35 0.052 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 35 0.052 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 35 0.052 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 35 0.052 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.052 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 34 0.091 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.091 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 34 0.091 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.091 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 34 0.091 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 34 0.091 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 34 0.12 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.12 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 34 0.12 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.12 At4g35240.1 68417.m05009 expressed protein contains Pfam domains... 33 0.16 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 33 0.16 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.16 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 33 0.16 At1g49270.1 68414.m05524 protein kinase family protein contains ... 33 0.16 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 33 0.21 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 33 0.21 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 33 0.21 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 33 0.28 At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 ... 33 0.28 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.28 At4g34440.1 68417.m04894 protein kinase family protein contains ... 33 0.28 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 33 0.28 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 33 0.28 At5g41580.1 68418.m05052 zinc finger (MIZ type) family protein c... 32 0.37 At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family p... 32 0.37 At4g18570.1 68417.m02749 proline-rich family protein common fami... 32 0.37 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 32 0.48 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 32 0.48 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 32 0.48 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 32 0.48 At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / ... 32 0.48 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 32 0.48 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 32 0.48 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 32 0.48 At1g80070.1 68414.m09373 splicing factor, putative strong simila... 32 0.48 At1g27710.1 68414.m03387 glycine-rich protein 32 0.48 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 31 0.64 At5g27870.1 68418.m03343 pectinesterase family protein similar t... 31 0.64 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 0.64 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 31 0.64 At3g23270.1 68416.m02933 regulator of chromosome condensation (R... 31 0.64 At3g22620.1 68416.m02856 protease inhibitor/seed storage/lipid t... 31 0.64 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 31 0.64 At1g69295.1 68414.m07947 beta-1,3-glucanase-related low similari... 31 0.64 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 31 0.64 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 31 0.64 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 31 0.85 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 31 0.85 At2g18470.1 68415.m02151 protein kinase family protein contains ... 31 0.85 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 31 0.85 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 31 0.85 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 1.1 At2g35530.1 68415.m04352 bZIP transcription factor family protei... 31 1.1 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 1.1 At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to ... 31 1.1 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.1 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 30 1.5 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 30 1.5 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 30 1.5 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 30 1.5 At3g20570.1 68416.m02604 plastocyanin-like domain-containing pro... 30 1.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 30 1.5 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 30 1.5 At5g24620.1 68418.m02908 thaumatin-like protein, putative simila... 30 2.0 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 2.0 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 30 2.0 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 30 2.0 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 30 2.0 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 30 2.0 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 30 2.0 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 30 2.0 At3g27320.1 68416.m03414 expressed protein low similarity to PrM... 30 2.0 At3g10720.2 68416.m01291 pectinesterase, putative contains simil... 30 2.0 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 30 2.0 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 30 2.0 At2g40820.1 68415.m05038 proline-rich family protein contains pr... 30 2.0 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.0 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 30 2.0 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 30 2.0 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 30 2.0 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 30 2.0 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 30 2.0 At5g58540.1 68418.m07330 protein kinase family protein contains ... 29 2.6 At5g54830.1 68418.m06829 DOMON domain-containing protein / dopam... 29 2.6 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 2.6 At5g04885.1 68418.m00512 glycosyl hydrolase family 3 protein con... 29 2.6 At4g30260.1 68417.m04302 integral membrane Yip1 family protein c... 29 2.6 At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TO... 29 2.6 At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TO... 29 2.6 At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TO... 29 2.6 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 2.6 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 29 2.6 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 29 2.6 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 2.6 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 29 2.6 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 29 2.6 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 29 2.6 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 29 2.6 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 29 3.4 At4g24660.1 68417.m03530 zinc finger homeobox family protein / Z... 29 3.4 At4g22540.1 68417.m03253 oxysterol-binding family protein simila... 29 3.4 At3g60270.1 68416.m06737 uclacyanin, putative similar to uclacya... 29 3.4 At3g04440.1 68416.m00470 expressed protein contains Pfam domain,... 29 3.4 At2g45000.1 68415.m05603 expressed protein contains Pfam profile... 29 3.4 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 29 3.4 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 29 3.4 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 3.4 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 4.5 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 29 4.5 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 29 4.5 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 29 4.5 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 4.5 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family p... 29 4.5 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 4.5 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 4.5 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 29 4.5 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 29 4.5 At5g51800.1 68418.m06423 expressed protein 28 6.0 At5g29020.1 68418.m03592 hypothetical protein 28 6.0 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 28 6.0 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 28 6.0 At4g18400.1 68417.m02731 expressed protein 28 6.0 At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family... 28 6.0 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 28 6.0 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 28 6.0 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 28 6.0 At1g52550.1 68414.m05932 expressed protein 28 6.0 At1g10620.1 68414.m01204 protein kinase family protein contains ... 28 6.0 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 7.9 At5g56890.1 68418.m07099 protein kinase family protein contains ... 28 7.9 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 28 7.9 At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99... 28 7.9 At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99... 28 7.9 At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99... 28 7.9 At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99... 28 7.9 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 28 7.9 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 7.9 At3g23130.1 68416.m02915 superman protein (SUP) / zinc finger (C... 28 7.9 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 28 7.9 At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family... 28 7.9 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 28 7.9 At2g25970.1 68415.m03117 KH domain-containing protein 28 7.9 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 28 7.9 At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 28 7.9 At1g17540.1 68414.m02157 protein kinase-related similar to serin... 28 7.9 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/49 (40%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IELAWRHNIMDFAMPYLIQTVRELTTKVEKL--EEADAKRXPRVRRDSE 142 +ELAW +N+MDFA PYL+Q +RE + KV++L ++ +A++ + + E Sbjct: 1597 LELAWINNMMDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEE 1645 >At3g11130.1 68416.m01349 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1705 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/49 (38%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = +2 Query: 2 IELAWRHNIMDFAMPYLIQTVRELTTKVEKL--EEADAKRXPRVRRDSE 142 +ELAW +N++DFA PYL+Q +RE + KV++L ++ +A++ + + E Sbjct: 1597 LELAWINNMIDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEE 1645 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPP----PTTGTACRTPPPASSGGTSLPTET 329 P ++ P+ P V PP P+P T P+PP PT TPP + + PT T Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPT 241 Query: 330 GALPHTDTTPHDS 368 P +T P D+ Sbjct: 242 PPTPIPETCPIDT 254 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSP----PPTTGTACRTPPPASSGGT 311 PT P ++ P+ P + PP P+P T P+P PPT TPP + Sbjct: 166 PTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVV 225 Query: 312 SLPTETGALPHTDTTPHDSRP*HPECP 392 + PT T + T TP P CP Sbjct: 226 TPPTPTPPVV-TPPTPTPPTPIPETCP 251 Score = 33.9 bits (74), Expect = 0.12 Identities = 26/84 (30%), Positives = 32/84 (38%), Gaps = 1/84 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS-PPPTTGTACRTPPPASSGGTSLP 320 PT+ P+ P P P P + P+ PPP+T PPP+ T P Sbjct: 86 PTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPS----TPKP 141 Query: 321 TETGALPHTDTTPHDSRP*HPECP 392 T P T PH P P CP Sbjct: 142 PTTKPPPSTPKPPHHKPPPTP-CP 164 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 3/72 (4%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT--SLPTETGALPHTDT-T 356 P P V PP P PPP+T T PP S+ P T P T T T Sbjct: 112 PKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPT 171 Query: 357 PHDSRP*HPECP 392 P P P P Sbjct: 172 PPVVTPPTPTPP 183 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 PP P+P P+P P T PP + T PT P T T P Sbjct: 165 PPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPT--PTPPVITPPTPTPP 213 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/84 (29%), Positives = 30/84 (35%), Gaps = 1/84 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSP-PPTTGTACRTPPPASSGGTSLP 320 P ++P P P V P P P YT P+P P T PPP + P Sbjct: 99 PPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Query: 321 TETGALPHTDTTPHDSRP*HPECP 392 T P TP+ P CP Sbjct: 159 TPEAPCPPPPPTPYPPPPKPETCP 182 Score = 33.1 bits (72), Expect = 0.21 Identities = 21/63 (33%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQA--PSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P PY PP P+PY P PPP TP P + PT P +T P Sbjct: 124 PPTPYT-PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Query: 360 HDS 368 D+ Sbjct: 183 IDA 185 Score = 31.9 bits (69), Expect = 0.48 Identities = 25/77 (32%), Positives = 29/77 (37%), Gaps = 5/77 (6%) Frame = +3 Query: 177 TAGPSMPYV-VPPQP-SPYGYTAQAPSPP---PTTGTACRTPPPASSGGTSLPTETGALP 341 T P PY+ PP P +P T + P PP P + PPP PT P Sbjct: 65 TVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPP 124 Query: 342 HTDTTPHDSRP*HPECP 392 T TP P P P Sbjct: 125 PTPYTPPPPTPYTPPPP 141 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/69 (28%), Positives = 23/69 (33%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P P V P P PY P+ P TPPP + PT P T P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Query: 366 SRP*HPECP 392 + CP Sbjct: 157 TPTPEAPCP 165 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD-TTPHDSRP 374 PP YGY P P P G+ PPP S G++ P G+ + P+ ++P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQP 61 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD-TTPHDSRP 374 PP YGY P P P G+ PPP S G++ P G+ + P+ ++P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQP 61 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD-TTPHDSRP 374 PP YGY P P P G+ PPP S G++ P G+ + P+ ++P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQP 61 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/71 (33%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAP---SPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 P P PP P PY Y++ P SPPP + +PPP S P + T Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPT 604 Query: 357 PHDSRP*HPEC 389 P S P P C Sbjct: 605 PVYSPPPPPPC 615 Score = 34.3 bits (75), Expect = 0.091 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 S P PP P P Y+ P PPP PPP P P T P Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Query: 369 RP*HPECP 392 P P P Sbjct: 541 PPHSPPPP 548 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 4/73 (5%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT----SLPTETGALPHTDT 353 P P PP P Y PSP PT R PPP S P + Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPP 564 Query: 354 TPHDSRP*HPECP 392 PH S P H P Sbjct: 565 PPHSSPPPHSPPP 577 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/78 (28%), Positives = 27/78 (34%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P + + P P + PP P P P PPP + PPP P + P Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPC-IEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSP 661 Query: 342 HTDTTPHDSRP*HPECPY 395 H S P PE Y Sbjct: 662 PPPPPVHYSSPPPPEVHY 679 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 8/71 (11%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAP------SPPPTTGTACRTPPPASSGGTSLPTETGALPHT 347 P + Y PP P P Y++ P SPPP+ PPP S+ P + H+ Sbjct: 654 PPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHS 713 Query: 348 DTTP--HDSRP 374 P H S P Sbjct: 714 PPPPMVHHSPP 724 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 S P PP P P Y+ P PPP +PPP S Sbjct: 450 SPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPS 486 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 PP P P Y+ PSPPP PPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + + P++ PP P P Y+ P PPP + PPP Sbjct: 413 PAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPP 456 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/68 (30%), Positives = 25/68 (36%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 S P P P+P T P PP + +PPP S P PH+ PH Sbjct: 520 SPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP----PHSSPPPHSP 575 Query: 369 RP*HPECP 392 P H P Sbjct: 576 PPPHSPPP 583 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVV-----PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P P L PS P V PP P P Y+ P PPP PPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/84 (27%), Positives = 27/84 (32%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P + P P P PP P P SPPP + PPP+ + T Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCT 535 Query: 324 ETGALPHTDTTPHDSRP*HPECPY 395 P P P PE PY Sbjct: 536 RPPPPPPHSPPPPQFSPPPPE-PY 558 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/69 (28%), Positives = 26/69 (37%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P + Y PP P Y Y++ P PPP ++ PPP P P + Sbjct: 634 PVVHYSSPPPPPVY-YSS--PPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYS 690 Query: 366 SRP*HPECP 392 S P P P Sbjct: 691 SPPPPPSAP 699 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P P PP P Y +P PPP + PPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/70 (30%), Positives = 24/70 (34%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P PY+ PP P SPPPT + PPP P + P H Sbjct: 584 PIYPYLSPPPPP-----TPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHY 638 Query: 366 SRP*HPECPY 395 S P P Y Sbjct: 639 SSPPPPPVYY 648 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/61 (37%), Positives = 27/61 (44%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 A P + PQ+ +AGP P PP P P + P PPP G PPP S G Sbjct: 369 APPPPVPAPQMPSSAGPPRP--PPPAPPP---GSGGPKPPPPPGPKGPRPPPPMSLGPKA 423 Query: 318 P 320 P Sbjct: 424 P 424 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/72 (23%), Positives = 21/72 (29%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P ++ + P P P PS G P PP + PPP G P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Query: 324 ETGALPHTDTTP 359 P P Sbjct: 416 PMSLGPKAPRPP 427 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/61 (37%), Positives = 27/61 (44%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 A P + PQ+ +AGP P PP P P + P PPP G PPP S G Sbjct: 369 APPPPVPAPQMPSSAGPPRP--PPPAPPP---GSGGPKPPPPPGPKGPRPPPPMSLGPKA 423 Query: 318 P 320 P Sbjct: 424 P 424 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/72 (23%), Positives = 21/72 (29%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P ++ + P P P PS G P PP + PPP G P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Query: 324 ETGALPHTDTTP 359 P P Sbjct: 416 PMSLGPKAPRPP 427 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 38.7 bits (86), Expect = 0.004 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = +3 Query: 216 PSPYGYTAQAPSPP-PTTGTACRTPPPASSG--GTSLPTETGALPHTD-TTPHDSRP*HP 383 PSP T +PSPP P T + TPPPA+S T+ P+ P T+ T+P S P P Sbjct: 5 PSPG--TTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPP 62 Query: 384 ECP 392 P Sbjct: 63 SLP 65 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +3 Query: 180 AGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS--LPTETGALPHTDT 353 A S P P P + + SPPP++ PPP+ G + LP + + P T + Sbjct: 30 AASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPS 89 Query: 354 TPHDSRP*HPECP 392 P + P +P P Sbjct: 90 PPSPTTPSNPRSP 102 Score = 36.7 bits (81), Expect = 0.017 Identities = 24/77 (31%), Positives = 35/77 (45%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P+ + P L + P PQPSP +P P PTT + R+PP + G + P Sbjct: 56 PSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSP-PSPTTPSNPRSPPSPNQGPPNTP- 113 Query: 324 ETGALPHTDTTPHDSRP 374 +G+ P T + S P Sbjct: 114 -SGSTPRTPSNTKPSPP 129 Score = 34.7 bits (76), Expect = 0.069 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL--PTETGALPHTDTTPHDSRP*H 380 PP S T SPPP+ T +PPP+S SL P+ G+L P S P Sbjct: 28 PPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPIT 87 Query: 381 PECP 392 P P Sbjct: 88 PSPP 91 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/64 (34%), Positives = 27/64 (42%) Frame = +3 Query: 150 MIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTET 329 M P T PS P PP S A S PP T T +PPP+ S ++ P + Sbjct: 1 MSTAPSPGTTPSPSPPS--PPTNSTTTTPPPAASSPPPT-TTPSSPPPSPSTNSTSPPPS 57 Query: 330 GALP 341 LP Sbjct: 58 SPLP 61 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 38.7 bits (86), Expect = 0.004 Identities = 31/94 (32%), Positives = 35/94 (37%), Gaps = 6/94 (6%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASS--GG 308 I P I P T P P V P P P P+PPP + PPPASS GG Sbjct: 101 IVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPE----QLPPPASSPQGG 156 Query: 309 TSLPTE----TGALPHTDTTPHDSRP*HPECPYR 398 P + P + P S P P P R Sbjct: 157 PKKPKKHHPGPATSPPAPSAPATSPPAPPNAPPR 190 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 249 SPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 S PP PP SS G++ P T + P + P DS P Sbjct: 7 SSPPAPSADSAPPPDTSSDGSAAPPPTDSAP-PPSPPADSSP 47 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 S P PP P P A P PPP PPP G + P P T P Sbjct: 506 SAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Query: 369 RP 374 P Sbjct: 566 PP 567 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P PP P P G A P PPP GT PPP Sbjct: 530 PRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPP-----ASSGGTSLPTETGALPHTDTTPHDSR 371 PP P P A P PPP +PPP + SGG P L + T P Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Query: 372 P 374 P Sbjct: 611 P 611 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + P +M + P PP P +A P PPP T PPP Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPP 525 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTP-PPASSGGTS 314 P PP P P G T AP PPP R P PP G S Sbjct: 543 PGTAAAPPPPPPPPG-TQAAPPPPPPPPMQNRAPSPPPMPMGNS 585 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTA--CRTPPPASSGGTSLPTETGA 335 P + L G + P PP G A P PPP G A PPP SL + A Sbjct: 595 PPMPLANGATPPPPPPPMAMANG-AAGPPPPPPRMGMANGAAGPPPPPGAARSLRPKKAA 653 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 + GP P PP P G T P PP PPP Sbjct: 587 SGGPPPP--PPPMPLANGATPPPPPPPMAMANGAAGPPP 623 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/63 (36%), Positives = 26/63 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P P + PPQ +P A P PPP PPPA + L T ALP P Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPL 151 Query: 366 SRP 374 S P Sbjct: 152 SPP 154 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/71 (30%), Positives = 25/71 (35%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P + P P PPQP P T P P PPP S+ + T ALP Sbjct: 34 PPCICICNPGPP---PPQPDPQPPTPPTFQPAPPANDQ-PPPPPQSTSPPPVATTPPALP 89 Query: 342 HTDTTPHDSRP 374 P S P Sbjct: 90 PKPLPPPLSPP 100 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/70 (30%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = +3 Query: 177 TAGPSMPYVVPPQP----SPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPH 344 T P P + PP P P A +PPP T PP P +T P Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Query: 345 TDTTPHDSRP 374 TP S P Sbjct: 162 PAITPPLSPP 171 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSP-PPTTGTACRTPPP 293 P + P P + PP P A P P PP TPPP Sbjct: 116 PAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPP 160 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 37.5 bits (83), Expect = 0.010 Identities = 26/75 (34%), Positives = 29/75 (38%), Gaps = 4/75 (5%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPP--QPSPYGYTAQAPSPPPTTGTACRT--PPPASSGGTSLPTET 329 P T P P PP PSP G T P P P+T T T PPP + S P+ Sbjct: 126 PAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSN 185 Query: 330 GALPHTDTTPHDSRP 374 P T P P Sbjct: 186 PTDPSTLAPPPTPLP 200 Score = 35.9 bits (79), Expect = 0.030 Identities = 23/80 (28%), Positives = 30/80 (37%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P +I P + + P P V+ P P P+PP T PPP +S PT Sbjct: 74 PPVITSPPPTVASSPPPPVVIA-SPPPSTPATTPPAPPQTVSPP---PPPDASPSPPAPT 129 Query: 324 ETGALPHTDTTPHDSRP*HP 383 T P +P P P Sbjct: 130 TTNPPPKPSPSPPGETPSPP 149 Score = 33.9 bits (74), Expect = 0.12 Identities = 29/87 (33%), Positives = 35/87 (40%), Gaps = 7/87 (8%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVV----PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT 311 P + P A PS P PP+PSP + PSPP T + PP S T Sbjct: 109 PPQTVSPPPPPDASPSPPAPTTTNPPPKPSP-SPPGETPSPPGETPS-----PPKPSPST 162 Query: 312 SLPTETGA---LPHTDTTPHDSRP*HP 383 PT T + P T +P S P P Sbjct: 163 PTPTTTTSPPPPPATSASPPSSNPTDP 189 Score = 32.3 bits (70), Expect = 0.37 Identities = 23/74 (31%), Positives = 32/74 (43%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 A P + +P P P PPQ SP + +P PP + +PPP+SS S Sbjct: 21 APPPLQTQPTTPSAPPPVTPPPSPPQ-SPPPVVSSSPPPPVVS-----SPPPSSSPPPSP 74 Query: 318 PTETGALPHTDTTP 359 P T P ++P Sbjct: 75 PVITSPPPTVASSP 88 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV--PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGA 335 P ++++ P P V PP SP SPPPT ++ P +S S P T Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP 107 Query: 336 LPHTDTTP 359 P +P Sbjct: 108 APPQTVSP 115 Score = 27.9 bits (59), Expect = 7.9 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 7/73 (9%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQ-APS---PPP--TTGTACRTP-PPASSGGTSLP 320 P T P+ P V P P P + AP+ PPP + TP PP + P Sbjct: 99 PSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Query: 321 TETGALPHTDTTP 359 + + P T T+P Sbjct: 159 SPSTPTPTTTTSP 171 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 37.1 bits (82), Expect = 0.013 Identities = 24/80 (30%), Positives = 32/80 (40%) Frame = +3 Query: 153 IIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG 332 I++ LML + P P+P A PP T TPPPA++ + P Sbjct: 5 IVQVFLMLALFATSALAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP-PPA 63 Query: 333 ALPHTDTTPHDSRP*HPECP 392 A P TTP P + P Sbjct: 64 ATPAPATTPPSVAPSPADVP 83 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 195 PYVVPPQ---PSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P PP P P A A PP T TPP + +PT + P T Sbjct: 39 PVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGPTVSPS 98 Query: 366 SRP 374 S P Sbjct: 99 SAP 101 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 37.1 bits (82), Expect = 0.013 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +3 Query: 105 TPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRT 284 +P+ G P++ P + + + PS P PSP T +P P P T + T Sbjct: 510 SPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPS---T 566 Query: 285 PPPASSGGTSLPTETGALPHTDTTPHDS 368 PP S G + P + P T +P S Sbjct: 567 PPTPISPGQNSPPIIPSPPFTGPSPPSS 594 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS-SGGTSLPTETGALPHTDTTP 359 PS P VP P+ PSP TP P S + PT G+ P + TTP Sbjct: 430 PSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTP 488 Score = 33.5 bits (73), Expect = 0.16 Identities = 24/84 (28%), Positives = 36/84 (42%) Frame = +3 Query: 108 PSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTP 287 P+ G P+++ P T P P P P+P G +P+ P G+ Sbjct: 440 PTTPSPGGSPPSPSIVPSPP-STTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGS----- 493 Query: 288 PPASSGGTSLPTETGALPHTDTTP 359 PP+S + PT G+ P + TTP Sbjct: 494 PPSS---PTTPTPGGSPPSSPTTP 514 Score = 33.5 bits (73), Expect = 0.16 Identities = 25/95 (26%), Positives = 36/95 (37%), Gaps = 9/95 (9%) Frame = +3 Query: 105 TPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPP--------P 260 +PS I P P ++ G + P ++P P +PSPP P Sbjct: 548 SPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPP 607 Query: 261 TTGTACRTPPPAS-SGGTSLPTETGALPHTDTTPH 362 G +PPP++ + GT L LP PH Sbjct: 608 IVGPTPSSPPPSTPTPGTLLHPHHLLLPQLSHLPH 642 Score = 33.5 bits (73), Expect = 0.16 Identities = 26/76 (34%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = +3 Query: 168 LMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHT 347 L LT + PP P+PY Y++ P PPP PPP PT P Sbjct: 689 LYLTCRHRLNLASPPPPAPYYYSSPQPPPPPHYS----LPPPT-------PTYHYISPPP 737 Query: 348 DTTPHDSRP--*HPEC 389 TP S P HP C Sbjct: 738 PPTPIHSPPPQSHPPC 753 Score = 31.5 bits (68), Expect = 0.64 Identities = 28/94 (29%), Positives = 32/94 (34%), Gaps = 2/94 (2%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPS--PYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 PT P + PS P PP PS P + SPP P P SS L Sbjct: 540 PTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Query: 318 PTETGALPHTDTTPHDSRP*HPECPYRLHKNFSL 419 P + P TP P P LH + L Sbjct: 600 PPVIPSPPIVGPTPSSPPPSTPTPGTLLHPHHLL 633 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 P PSP G + +PS P+ +PP S G S P+ + TTP P Sbjct: 414 PTTPSPGG-SPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSP 468 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPA 296 P++ Y PP PSP Y+ P PP PPPA Sbjct: 762 PTVHYNPPPPPSPAHYS--PPPSPPVYYYNSPPPPPA 796 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT-SLPTETGALPHTDT 353 T G S P P P+P G +P+ P G+ +P S GG+ P+ + + P T Sbjct: 476 TPGGSPPSS-PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVP 534 Query: 354 TPHDSRP*HPECP 392 +P S P P P Sbjct: 535 SP-PSTPTSPGSP 546 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPA--SSGGTSLPTETGALPHTDTTP 359 P P P PSP Y +P PPP + PPP S P G LP Sbjct: 771 PPSPAHYSPPPSPPVYYYNSPPPPPAVHYS-PPPPPVIHHSQPPPPPIYEGPLPPIPGIS 829 Query: 360 HDSRP*HP 383 + S P P Sbjct: 830 YASPPPPP 837 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 36.3 bits (80), Expect = 0.022 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +3 Query: 153 IIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG 308 + PQ PS PY P P P G + + +PP T TA PPPA+ G Sbjct: 216 VTTPQAPYVRPPSAPYARTP-PQPLGSHSLSGNPPLTPFTAPSMPPPATFPG 266 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 36.3 bits (80), Expect = 0.022 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGP--SMPYVVPPQPSPYGYT-AQAPSPPPTTGTACRTPPPASSGG 308 A P + P + + P + P V P P+P AQ P+P PTT +P P+SS Sbjct: 85 ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSS-- 142 Query: 309 TSLPTETGALPHTDT 353 LP+ P TD+ Sbjct: 143 PPLPSSDAPGPSTDS 157 Score = 32.3 bits (70), Expect = 0.37 Identities = 25/81 (30%), Positives = 31/81 (38%), Gaps = 2/81 (2%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS--PPPTTGTACRTPPPASSGGT 311 A PT P S P V P P TA P+ PPP + +PPPA+ Sbjct: 32 APPTPTTPPPAATPPPVSAPPPVTTSPPPVT-TAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 312 SLPTETGALPHTDTTPHDSRP 374 + P A P T P + P Sbjct: 91 ASPPPPVASPPPATPPPVATP 111 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +3 Query: 228 GYTAQAPSPPPTTGTA---CRTPPPASSGG--TSLPTETGALPHTDTTPHDSRP*HP 383 G T QAP+ PPT A TPPPA++ ++ P T + P T P + P P Sbjct: 17 GVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 TA P+ P P P+ AP P T+ T PP ++ + + A P T Sbjct: 28 TATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Query: 357 PHDSRP*HP 383 P + P P Sbjct: 88 PPVASPPPP 96 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 36.3 bits (80), Expect = 0.022 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGP--SMPYVVPPQPSPYGYT-AQAPSPPPTTGTACRTPPPASSGG 308 A P + P + + P + P V P P+P AQ P+P PTT +P P+SS Sbjct: 85 ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSS-- 142 Query: 309 TSLPTETGALPHTDT 353 LP+ P TD+ Sbjct: 143 PPLPSSDAPGPSTDS 157 Score = 32.3 bits (70), Expect = 0.37 Identities = 25/81 (30%), Positives = 31/81 (38%), Gaps = 2/81 (2%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS--PPPTTGTACRTPPPASSGGT 311 A PT P S P V P P TA P+ PPP + +PPPA+ Sbjct: 32 APPTPTTPPPAATPPPVSAPPPVTTSPPPVT-TAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 312 SLPTETGALPHTDTTPHDSRP 374 + P A P T P + P Sbjct: 91 ASPPPPVASPPPATPPPVATP 111 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +3 Query: 228 GYTAQAPSPPPTTGTA---CRTPPPASSGG--TSLPTETGALPHTDTTPHDSRP*HP 383 G T QAP+ PPT A TPPPA++ ++ P T + P T P + P P Sbjct: 17 GVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPP 73 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 TA P+ P P P+ AP P T+ T PP ++ + + A P T Sbjct: 28 TATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Query: 357 PHDSRP*HP 383 P + P P Sbjct: 88 PPVASPPPP 96 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 35.9 bits (79), Expect = 0.030 Identities = 22/66 (33%), Positives = 28/66 (42%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P+L+ PS PP PS G P PPP + PPP S S+P +T + Sbjct: 630 PRLVRVGSPS-----PPPPSMSGGAPPPPPPPPMLVASRTAPPPHLSHVRSIPFQTRLVM 684 Query: 342 HTDTTP 359 T P Sbjct: 685 GTSPLP 690 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 186 PSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P M VP P P P APSPPP +G PPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPP 51 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/64 (31%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPP--TTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P V P P P +PSPPP +G A PPP S L H + P Sbjct: 618 PPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPPMLVASRTAPPPHLSHVRSIP 677 Query: 360 HDSR 371 +R Sbjct: 678 FQTR 681 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 35.9 bits (79), Expect = 0.030 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 T GP P P SP PSP PT G P P LP G P + T Sbjct: 183 TPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLP---GPPPSSSPT 239 Query: 357 PHDSRP 374 P P Sbjct: 240 PGPDSP 245 Score = 34.3 bits (75), Expect = 0.091 Identities = 22/75 (29%), Positives = 30/75 (40%) Frame = +3 Query: 150 MIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTET 329 +++ ++ ++ P +P PP PSP PSP PT G P P LP Sbjct: 149 LLLSVIVLWSSDPPLPPPPPPYPSPL---PPPPSPSPTPGPDSPLPSPGPDSPLPLP--- 202 Query: 330 GALPHTDTTPHDSRP 374 G P TP P Sbjct: 203 GPPPSPSPTPGPDSP 217 Score = 28.3 bits (60), Expect = 6.0 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 6/84 (7%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTP---PPASSGGTSLPTETGALPHT 347 T GP P P SP PS PT G P PP S T P P Sbjct: 211 TPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGP 270 Query: 348 DT---TPHDSRP*HPECPYRLHKN 410 D+ +P P P+ KN Sbjct: 271 DSPLPSPGPDPPLPSPGPHLYEKN 294 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 35.5 bits (78), Expect = 0.039 Identities = 28/78 (35%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQ-APSPPPTTGTACRTPPPASSGGTSLPTETGAL 338 P L + PS P P P P Q AP+PPP+ C PP A P ++ AL Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPS--DHCLPPPTAPLA----PAQSIAL 1179 Query: 339 PHTDTTPHDSRP*HPECP 392 P + T S P HP P Sbjct: 1180 PPSSIT-RPSMPSHPSLP 1196 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 35.5 bits (78), Expect = 0.039 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = +3 Query: 186 PSMPYVV-PPQPSPYGYTAQAPSP-----PPTTGTACRTPPP 293 P PYV PP PSPY Y + PSP PP +PPP Sbjct: 36 PPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPP 77 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 7/55 (12%) Frame = +3 Query: 186 PSMPYVVP-PQPSPYGYTAQAPSP------PPTTGTACRTPPPASSGGTSLPTET 329 P PY+ P P PY Y + P P PP ++PPP +S P T Sbjct: 56 PPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPT 110 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 8/49 (16%) Frame = +3 Query: 171 MLTAGPSMPYVV--PPQPSPYGYTA--QAP----SPPPTTGTACRTPPP 293 + ++ P PYV PP P PY Y + + P SPPP PPP Sbjct: 61 LYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPP 109 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.5 bits (78), Expect = 0.039 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL-PTETGA 335 PP P P T AP PPP + T PPP GTS P GA Sbjct: 716 PPPPPPLSKTP-APPPPPLSKTPVPPPPPGLGRGTSSGPPPLGA 758 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT 311 P+ I P L P P PP PS + + PPP PPP S G T Sbjct: 583 PSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPP-------PPPPPSFGST 631 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/66 (28%), Positives = 23/66 (34%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P+ ++ P P P PS A P PPP PPP S P G Sbjct: 688 PKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGR 747 Query: 342 HTDTTP 359 T + P Sbjct: 748 GTSSGP 753 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +3 Query: 174 LTAGPSMPYVVPPQPSPYGYTAQAPSPP-----PTTGTACRTPPP 293 + GP PP P P + AP PP P + T PPP Sbjct: 672 IRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPP 716 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRT-PPPASSGGTSLP 320 P + P P P T P PPP G + PPP + G++ P Sbjct: 720 PPLSKTPAPPPPPLSKTP-VPPPPPGLGRGTSSGPPPLGAKGSNAP 764 Score = 27.9 bits (59), Expect = 7.9 Identities = 22/58 (37%), Positives = 25/58 (43%), Gaps = 6/58 (10%) Frame = +3 Query: 162 PQLMLTAGPSMPYV----VPPQPSPYGY-TAQAPSPPPTTGT-ACRTPPPASSGGTSL 317 P L T P P + VPP P G T+ P P G+ A PPPA G SL Sbjct: 720 PPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGRGRASL 777 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV PSP Y ++P PPP+ + +PPP Sbjct: 433 PPYVYSSPPPPPYVYK-SPSPPPYVYKSPPPPPSYSYSYSSPPP 475 Score = 33.1 bits (72), Expect = 0.21 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 P + + P PYV P P PY Y ++PSPPP + PPP+ S S P Sbjct: 423 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPSPPPYVYKS-PPPPPSYSYSYSSP 473 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P PSPY Y ++P PPP ++ PP Sbjct: 343 PPYVYKSPPPPPYVYSSPPPSPYVY--KSPPPPPYVYSSPPPPP 384 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP 290 P+ + +P + + P P V P P Y ++P PPP ++ PP Sbjct: 36 PSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 84 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 353 PPYVYSSPPPSPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 392 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 153 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 192 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 173 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 212 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 193 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 232 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 213 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 252 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 233 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 272 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 253 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 292 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 273 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 312 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 293 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 332 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 373 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 412 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 393 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 432 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PY+ P P PY Y++ P PPP ++PPP Sbjct: 93 PPYVYSSPPPPPYIYKSPPPPPYVYSS--PPPPP---YVYKSPPP 132 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y + P PPP ++PPP Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYNS--PPPPP---YVYKSPPP 152 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + + P PYV P P PY Y++ P PPP ++PPP Sbjct: 133 PPYVYNSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 172 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y + P PPP ++PPP Sbjct: 313 PPYVYSSPPPPPYVYKSPPPPPYVYNS--PPPPP---YVYKSPPP 352 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + ++ P PYV P P PY Y++ P PPP + PP Sbjct: 413 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPPYVYKSPSPPP 454 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PY+ P P PY Y++ P PPP ++PPP Sbjct: 53 PPYVYSSPPPPPYIYKSPPPPPYVYSS--PPPPP---YIYKSPPP 92 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PY+ P P PY Y++ P PPP ++PPP Sbjct: 73 PPYVYSSPPPPPYIYKSPPPPPYVYSS--PPPPP---YIYKSPPP 112 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 123 PPYVYKSPPPPPYVYNSPPPPPYVY--KSPPPPPYVYSSPPPPP 164 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 143 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 184 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 163 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 204 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 224 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 203 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 244 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 223 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 264 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 243 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 284 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 263 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 304 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 283 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 324 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 383 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 424 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 403 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 444 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 63 PPYIYKSPPPPPYVYSSPPPPPYIY--KSPPPPPYVYSSPPPPP 104 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 83 PPYIYKSPPPPPYVYSSPPPPPYIY--KSPPPPPYVYSSPPPPP 124 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP + PP Sbjct: 103 PPYIYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYNSPPPPP 144 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP + PP Sbjct: 303 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYNSPPPPP 344 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPPPA 296 P + + P PYV P P PY Y ++P PPP + +PPP+ Sbjct: 323 PPYVYKSPPPPPYVYNSPPPPPYVY--KSPPPPPYVYS---SPPPS 363 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 186 PSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P PYV P P PY Y ++P PPP ++ PP Sbjct: 371 PPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 404 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.5 bits (78), Expect = 0.039 Identities = 25/78 (32%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTET-GAL 338 P LT P V P P P P+ P +PPP SS PTE Sbjct: 78 PSPSLTGPPPTTIPVSPPPEP-SPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTT 136 Query: 339 PHTDTTPHDSRP*HPECP 392 P T +P + P PE P Sbjct: 137 PITSPSPPTNPPPPPESP 154 Score = 34.7 bits (76), Expect = 0.069 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P L + P+ PP+ P ++ PS PP+ PPP P G+ Sbjct: 179 PPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKR 238 Query: 342 HTDTTPHDS---RP*HPECP 392 T + P S RP HP P Sbjct: 239 PTPSPPSPSDSKRPVHPSPP 258 Score = 33.9 bits (74), Expect = 0.12 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTET--GALPHTDTTPHDSRP*H 380 PP+PSP + PPPTT +PPP S LPTE A P + P S P Sbjct: 72 PPEPSPP--SPSLTGPPPTTIPV--SPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP 127 Query: 381 P 383 P Sbjct: 128 P 128 Score = 32.7 bits (71), Expect = 0.28 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 7/56 (12%) Frame = +3 Query: 180 AGPSMPYVVPPQPSPYGYTAQAP-------SPPPTTGTACRTPPPASSGGTSLPTE 326 A P + + PPQPS G A +P +PP TT T ++ PP + +S P E Sbjct: 19 ASPPLMALPPPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPE 74 Score = 31.1 bits (67), Expect = 0.85 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPP----PTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 PP+PSP + + SPP P++ + +PP S G P+ P TD + Sbjct: 267 PPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTPVTDNS 320 Score = 30.3 bits (65), Expect = 1.5 Identities = 25/88 (28%), Positives = 33/88 (37%), Gaps = 2/88 (2%) Frame = +3 Query: 144 PTMI-IEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 PT I + P + P +P PP +P SPPP T PP S P Sbjct: 87 PTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPT--EAPPTTPITSPSPP 144 Query: 321 TETGALPHT-DTTPHDSRP*HPECPYRL 401 T P + + P P +P P +L Sbjct: 145 TNPPPPPESPPSLPAPDPPSNPLPPPKL 172 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/69 (28%), Positives = 27/69 (39%) Frame = +3 Query: 210 PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPEC 389 P P P G+ + PPP G+ TP P S + P P + P ++ P Sbjct: 217 PSPPPPGHPKRREQPPP-PGSKRPTPSPPSPSDSKRPVH----PSPPSPPEETLPPPKPS 271 Query: 390 PYRLHKNFS 416 P L N S Sbjct: 272 PDPLPSNSS 280 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 35.1 bits (77), Expect = 0.052 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 174 LTAGPSMPYVVPP-QPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD 350 +T P P PP P+P +T+ P PPP P P S+G +++ + A P Sbjct: 703 VTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPA-PPTPQSNGISAMKSSPPAPPAPP 761 Query: 351 TTP-HDSRP*HPECP 392 P H + P P P Sbjct: 762 RLPTHSASPPPPTAP 776 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/74 (29%), Positives = 31/74 (41%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 A PT I+ T+ P P PP P+P P+P +A ++ PPA L Sbjct: 716 APPTPIVH-----TSSPPPPPPPPPPPAP-------PTPQSNGISAMKSSPPAPPAPPRL 763 Query: 318 PTETGALPHTDTTP 359 PT + + P P Sbjct: 764 PTHSASPPPPTAPP 777 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = +3 Query: 180 AGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 A P+ P + SP TA P P T PPP GT L +P T P Sbjct: 756 APPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALP 815 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQA---PSPPPTTGTACRTPPPASSGGTSLPT 323 P + T S P P P P G T P PPP GT P +LPT Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALPT 816 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 Query: 246 PSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P PP T+ +P P+S SL A P T T P Sbjct: 603 PPTPPLASTSHASPEPSSKTTNSLLLSPQASPATPTNP 640 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 35.1 bits (77), Expect = 0.052 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG 308 P P PP P + +P PP T TAC PPP+SSGG Sbjct: 40 PCQPNPSPPPPP----SNPSPPPPSPTTTAC-PPPPSSSGG 75 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL--PTETGALPHT 347 PP PS G PP + + R PP +SSGG P G P+T Sbjct: 67 PPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSGGNYPYT 115 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/72 (31%), Positives = 29/72 (40%) Frame = +3 Query: 105 TPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRT 284 +PS+ +C +P PS P PP PSP TA P P + G Sbjct: 24 SPSQIADCTMCTSCDNPCQPNPSPPPPPSNPS--PPPPSPTT-TACPPPPSSSGGGPYYY 80 Query: 285 PPPASSGGTSLP 320 PPAS G+ P Sbjct: 81 YPPASQSGSYRP 92 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.1 bits (77), Expect = 0.052 Identities = 27/106 (25%), Positives = 40/106 (37%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS 314 ++ P + P GP + P P+P Y AP+ P PPA + S Sbjct: 64 VSAPNLAFGPAPSFAPGPGPSFAPGPAPNPRSYDWLAPASSP-------NEPPAETPDES 116 Query: 315 LPTETGALPHTDTTPHDSRP*HPECPYRLHKNFSLDKKI*IMLLST 452 P+ + P P S P P P + K + K+ I + ST Sbjct: 117 SPSPSEETPSV-VAPSQSVPGPPRPPPQREKKDDILMKLIIAVAST 161 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/78 (33%), Positives = 29/78 (37%), Gaps = 3/78 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP---PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG 332 P L L G S P P P P P P PPP A PPPA G + P G Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIA--RPPPAPPKGAA-PKRQG 310 Query: 333 ALPHTDTTPHDSRP*HPE 386 D + DS P+ Sbjct: 311 NTSSGDASDVDSETGAPK 328 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/58 (32%), Positives = 24/58 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P P PQP P A+ P PP R +S + + +ETGA P T P Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNTSSGDASDVDSETGA-PKTKLKP 333 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 35.1 bits (77), Expect = 0.052 Identities = 25/67 (37%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSP-PPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSR 371 P V PP P+P T PSP PP +PPP S PT + P D TP Sbjct: 149 PPVSPPPPTP---TPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP-PDVTPTPPT 204 Query: 372 P*HPECP 392 P P P Sbjct: 205 PSVPSPP 211 Score = 33.9 bits (74), Expect = 0.12 Identities = 28/101 (27%), Positives = 37/101 (36%), Gaps = 5/101 (4%) Frame = +3 Query: 105 TPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRT 284 TPS ++ P P + P P P PS T PPPT + + Sbjct: 87 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPS 146 Query: 285 P-----PPASSGGTSLPTETGALPHTDTTPHDSRP*HPECP 392 P PP + S+P+ T +P TD P P P P Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVP-TDPMPSPPPPVSPPPP 186 Score = 33.1 bits (72), Expect = 0.21 Identities = 26/85 (30%), Positives = 33/85 (38%), Gaps = 1/85 (1%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPS-PYGYTAQAPSPPPTTGTACRTPPPASSGGT 311 + PT + P T PS+P PP P+ P SPPP T T PP + Sbjct: 144 VPSPTPPVSPPPP-TPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTP 202 Query: 312 SLPTETGALPHTDTTPHDSRP*HPE 386 P+ T T P S P P+ Sbjct: 203 PTPSVPSPPDVTPTPPTPSVPSPPD 227 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 P V PP P+P T PSPP T T P+ T P D TP P Sbjct: 179 PPVSPPPPTP---TPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 235 Score = 31.5 bits (68), Expect = 0.64 Identities = 24/66 (36%), Positives = 27/66 (40%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 T PS+P PP +P T PSPP T TPP S T T P + T Sbjct: 187 TPTPSVPS--PPDVTPTPPTPSVPSPPDVT----PTPPTPSVPSPPDVTPTPPTPPSVPT 240 Query: 357 PHDSRP 374 P S P Sbjct: 241 PSGSPP 246 Score = 31.1 bits (67), Expect = 0.85 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 PT + +T P P V PP +P T PSPP T T TPP S+P Sbjct: 188 PTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP-PTPP-------SVP 239 Query: 321 TETGALPH 344 T +G+ P+ Sbjct: 240 TPSGSPPY 247 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAP--SPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 +P V PP P+P + P PPPT + +P P S PT + P +P Sbjct: 78 VPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Query: 366 SRP 374 P Sbjct: 138 PTP 140 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/70 (32%), Positives = 26/70 (37%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPH 362 G + P VPP SP T PSP P PPP + PT + P TP Sbjct: 71 GYTPPAPVPPV-SPPPPTPSVPSPTPPVS----PPPPTPTPSVPSPTPPVSPPPPTPTPS 125 Query: 363 DSRP*HPECP 392 P P P Sbjct: 126 VPSPTPPVSP 135 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 35.1 bits (77), Expect = 0.052 Identities = 26/84 (30%), Positives = 31/84 (36%), Gaps = 3/84 (3%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS---PPPTTGTACRTPPPASSGGTS 314 PT P+ + GPS V PP PSP P PP + + C +PPP Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQ---P 60 Query: 315 LPTETGALPHTDTTPHDSRP*HPE 386 P A P T P PE Sbjct: 61 KPVPPPACPPTPPKPQPKPAPPPE 84 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSP---PPTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 GPS PP+P P A +PSP PP PPPA P A P Sbjct: 27 GPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPK 86 Query: 354 TPHDSRP*HPECP 392 P CP Sbjct: 87 PAPPPAPKPVPCP 99 >At4g23882.1 68417.m03434 heavy-metal-associated domain-containing protein Length = 284 Score = 34.3 bits (75), Expect = 0.091 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 174 LTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG 308 + A S P V PP + G+T P PPP+ R PPP + G Sbjct: 216 INAAMSPPMVYPPPQAVPGFTTPIPYPPPSFFPG-RPPPPYTGAG 259 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 34.3 bits (75), Expect = 0.091 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = +3 Query: 123 ECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAP---SPPPTTGTACRTPPP 293 +CG +++P + A P P PP P P +P SPPP+ PPP Sbjct: 390 DCGSFGCGRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Query: 294 A 296 + Sbjct: 450 S 450 Score = 32.3 bits (70), Expect = 0.37 Identities = 24/68 (35%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPA--SSGGTSLPTETGALPHTDTTP 359 P P V P PSP Y+ P PPP+ + PPP SS P G LP Sbjct: 428 PPSPPVFSPPPSPPVYS---PPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPVIGVS 484 Query: 360 HDSRP*HP 383 + S P P Sbjct: 485 YASPPPPP 492 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 34.3 bits (75), Expect = 0.091 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 204 VPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPH 344 +PP P P + AQ P PPP +G PPP ++ G G H Sbjct: 229 LPPPPPPPPHQAQPP-PPPPSGLFPPPPPPMANNGFRPMPPAGGFGH 274 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 186 PSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG 308 P P+ PP P P G P PPP R PPA G Sbjct: 234 PPPPHQAQPPPPPPSGLF--PPPPPPMANNGFRPMPPAGGFG 273 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.3 bits (75), Expect = 0.091 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P Y P P Y T P PPP T A ++PPP Sbjct: 599 PYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPP 634 Score = 31.5 bits (68), Expect = 0.64 Identities = 22/62 (35%), Positives = 25/62 (40%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPE 386 PP PSP Y SPPP + T PPAS S P E + P S H + Sbjct: 733 PPPPSPVYYPPVTQSPPPPS-TPVEYHPPASPN-QSPPPEYQSPPPKGCNDSPSNDHHYQ 790 Query: 387 CP 392 P Sbjct: 791 TP 792 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTT----GTACRTPPP 293 PP P P Y Q+P PPP TA PPP Sbjct: 619 PPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGT----ACRTPPPASS 302 PP PSP Y A SPPP + ++PPP S+ Sbjct: 718 PPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPST 753 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P+ T P Y P P Y YT+ PPP T A ++PPP Sbjct: 581 PKYEQTPSPR-EYYPSPSPPYYQYTSS---PPPPTYYATQSPPP 620 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/72 (31%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = +3 Query: 90 SLKKQTPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPS---PYGYTA-QAPSPP 257 S+K P E + P E + A P P + PP PS PY Y++ PSP Sbjct: 496 SVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPS 555 Query: 258 PTTGTACRTPPP 293 P +PPP Sbjct: 556 PPPPYIYSSPPP 567 Score = 28.7 bits (61), Expect = 4.5 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAP--SPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPH 362 S P P P PY Y++ P + PPTT ++PPP T P E P + Sbjct: 548 SPPPPSPSPPPPYIYSSPPPVVNCPPTT----QSPPPPKYEQTPSPREYYPSPSPPYYQY 603 Query: 363 DSRP*HP 383 S P P Sbjct: 604 TSSPPPP 610 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 4/64 (6%) Frame = +3 Query: 123 ECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQP-SPYGYTAQAPSPPPTTGTA---CRTPP 290 +C + P P++ + PP P S T +A PPP++ + TPP Sbjct: 413 DCSKFGCNNFFSPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPP 472 Query: 291 PASS 302 P SS Sbjct: 473 PPSS 476 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTG-TACRTPPPAS 299 P + PP P Y Q+P PPP ++PPP S Sbjct: 684 PPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPS 722 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 195 PYVVPPQPSPYGYTA--QAPSPPPT-TGTACRTPPP 293 P P P P YT Q+P PPP ++PPP Sbjct: 642 PVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPP 677 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 34.3 bits (75), Expect = 0.091 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 PP P P A P PPP G A PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPP-TTGTACRTPPPASSGGTSLP 320 PS PP P G A P PPP G PPP S G P Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 Score = 31.5 bits (68), Expect = 0.64 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +3 Query: 174 LTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 LT G PP P P PPP + A PPP G + P Sbjct: 361 LTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPP 409 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG 332 P PP P P G P PPP + PP G PT++G Sbjct: 401 PKKGPAAPPPPPPPGKKGAGPPPPPPMS---KKGPPKPPGNPKGPTKSG 446 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P PP P P AP PPP G PPP Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 GP+ PP P P A P PPP PPP G Sbjct: 377 GPANQTSPPPPPPPSA--AAPPPPPPPKKGPAAPPPPPPPG 415 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 34.3 bits (75), Expect = 0.091 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV PP P PY Y Q+P PPP ++ PP Sbjct: 153 PPYVYKSPPPPPYVYSPPPPPPYVY--QSPPPPPYVYSSPPPPP 194 Score = 32.7 bits (71), Expect = 0.28 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGAL 338 P + ++ P PYV P P PY Y++ P PPP ++PPP TS P Sbjct: 283 PPYVYSSPPPPPYVYSSPPPPPYVYSS--PPPPP---YVYKSPPPPPYVYTSPPPPPYVY 337 Query: 339 PHTDTTPHDSRP*HPECPY 395 P+ P PY Sbjct: 338 KSPPPPPYVDSYSPPPAPY 356 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + P + ++ P PYV P P PY Y + P PPP ++ PP Sbjct: 57 PYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNS--PPPPPYVYSSPPPPP 104 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 73 PPYVYSSPPPPPYVYNSPPPPPYVYSS--PPPPP---YVYKSPPP 112 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 93 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 132 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + ++ P PYV P P PY Y++ P PPP ++ PP Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPPYVYSSPPPPP 154 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 183 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 222 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 203 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 242 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 223 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 262 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y++ P PPP ++PPP Sbjct: 243 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPP---YVYKSPPP 282 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + ++ P PYV P P PY Y++ P PPP ++ PP Sbjct: 263 PPYVYSSPPPPPYVYKSPPPPPYVYSS--PPPPPYVYSSPPPPP 304 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 83 PPYVYNSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 124 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 103 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 144 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + + P PYV P P PY Y++ P PPP ++PPP Sbjct: 123 PPYVYKSPPPPPYVYSSPPPPPYVYSS--PPPPP---YVYKSPPP 162 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + ++ P PYV P P PY Y ++P PPP + PP Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSPPPPPP 174 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + + P PYV P P PY Y++ P PPP ++PPP Sbjct: 163 PPYVYSPPPPPPYVYQSPPPPPYVYSS--PPPPP---YVYKSPPP 202 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 173 PPYVYQSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 214 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 193 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 234 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 213 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 254 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 233 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 274 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y ++P PPP ++ PP Sbjct: 253 PPYVYKSPPPPPYVYSSPPPPPYVY--KSPPPPPYVYSSPPPPP 294 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPP 290 P + + P PYV P P PY Y++ P PPP ++ PP Sbjct: 273 PPYVYKSPPPPPYVYSSPPPPPYVYSS--PPPPPYVYSSPPPPP 314 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVP-PQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + ++ P PYV P P PY Y+ P PPP ++PPP Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSP--PPPPP---YVYQSPPP 182 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYT-AQAP---SPPPTTGTACRTPPPASS 302 P + + P PYV P P Y Y+ AP PPP ++ PP SS Sbjct: 387 PYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPYYSS 437 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD 350 P P++ P P AP PPP G PPP + GG P GA P + Sbjct: 252 PPPPHIGGSAPPPPHMGGSAP-PPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNN 305 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD-SRP*HP 383 PPQ P G P PPP G + PPP GG++ P + P++ P HP Sbjct: 242 PPQRPPMG----GPPPPPHIGGSA--PPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHP 295 Query: 384 ECPY 395 PY Sbjct: 296 P-PY 298 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.9 bits (74), Expect = 0.12 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +3 Query: 144 PTMIIEPQLMLTAG--PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 PT++ + +++ P P PP PSP PSPPP + PPPA + G + Sbjct: 49 PTIVHQSAIVVVVDEPPPPPPTSPPPPSP-----PPPSPPPPSPPPPSPPPPAFAVGKT- 102 Query: 318 PTETGALPHTDTTPHDSRP*H--PECPY 395 P +RP + ECPY Sbjct: 103 PEGCDVFKGNWVKDWSTRPLYRESECPY 130 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 219 SPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPECP 392 S + AQ P+ P T T PPP T+ P T A P T TTP S P P Sbjct: 18 SSFSVNAQGPAASPVTSTT-TAPPPT----TAAPPTTAAPPPTTTTPPVSAAQPPASP 70 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/83 (28%), Positives = 31/83 (37%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 PT P++ P+ P PPQ P +A SPPP + PPPA + P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPA--SAPTVSPPPVS------PPPAPTSPPPTPA 130 Query: 324 ETGALPHTDTTPHDSRP*HPECP 392 P + S P P P Sbjct: 131 SPPPAPASPPPAPASPPPAPVSP 153 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 A P P + P+ P PP +P + AP P A P P S S Sbjct: 51 APPPTTTTPPVSAAQPPASPVTPPPAVTP--TSPPAPKVAPVISPATPPPQPPQSPPASA 108 Query: 318 PT 323 PT Sbjct: 109 PT 110 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTAC--RTPPP 293 P + + P PYV P PY Y++ P PPP+ C +PPP Sbjct: 496 PPPYVYSSPPPPYVYSSPPPPYVYSS-PPPPPPSPPPPCPESSPPP 540 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 8/74 (10%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPP------QPSPYGYTAQAPSPPPTTGTACR--TPPPAS 299 P+ + PQ+ + P P PP PSP Y PSPPP + TP P Sbjct: 600 PSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPP 659 Query: 300 SGGTSLPTETGALP 341 P+ET + P Sbjct: 660 PSPVYYPSETQSPP 673 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTG---TACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP* 377 PP PSP Y ++ SPPP T + ++PPP + P + A P + P S Sbjct: 657 PPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQ--ATPSYEPPPEYSYSS 714 Query: 378 HPECP 392 P P Sbjct: 715 SPPPP 719 Score = 31.9 bits (69), Expect = 0.48 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 P + ++ P PYV P PY Y+ SPPP + PPP S Sbjct: 487 PPYVYSSPPPPPYVYSSPPPPYVYS----SPPPPYVYSSPPPPPPS 528 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAP------SPPPTTGTACRTPPP 293 P PYV P PY Y++ P SPPP PPP Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTT----GTACRTPPPAS 299 PP PSP Y PSPPP + +PPP S Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPS 631 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 6/72 (8%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSP-----PPTTGTACRTPPPASSGGTSLPT 323 P + + P PYV P P PY Y++ P P PP PPP P Sbjct: 467 PPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPP 526 Query: 324 ETGALPHTDTTP 359 + P +++P Sbjct: 527 PSPPPPCPESSP 538 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/85 (24%), Positives = 29/85 (34%), Gaps = 1/85 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS-SGGTSLP 320 P+ + P + P Y P SP A PP + PP S S P Sbjct: 660 PSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPP 719 Query: 321 TETGALPHTDTTPHDSRP*HPECPY 395 + T P + +D+ P P Y Sbjct: 720 SPTSYFPPMPSVSYDASPPPPPSYY 744 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV----PPQPSPYGYTAQAPSPPPTT--GTACRTPPPAS 299 P + + P PYV PP PSP ++ PPP ++PPP S Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPS 556 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGT----ACRTPPPAS 299 PP PSP Y SPPP + +PPP S Sbjct: 552 PPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPS 586 >At4g35240.1 68417.m05009 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 828 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPP---------TTGTACRTPPPASS 302 PQ + S Y PPQ S +GY+ P P P TT A + PPP S Sbjct: 216 PQRVYIGESSSSYPYPPQNSYFGYSNPVPGPGPGYYGSSSASTTAAATKPPPPPPS 271 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 33.5 bits (73), Expect = 0.16 Identities = 27/78 (34%), Positives = 33/78 (42%), Gaps = 4/78 (5%) Frame = +3 Query: 171 MLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP-PASSGGTSLPTET---GAL 338 +L A PS P PS T PS PP+T + +PP P S SLP + A Sbjct: 118 VLAAAPS-----PSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSAS 172 Query: 339 PHTDTTPHDSRP*HPECP 392 P T+ TP P P Sbjct: 173 PPTNGTPDSETLTPPPAP 190 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/68 (30%), Positives = 25/68 (36%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 S P + +P T PSPPP PPP S P+ T +PH S Sbjct: 69 SAPAISISPSTPIPSTPSTPSPPPPAPKKS-PPPPTPKKSPSPPSLTPFVPHPTPKKSPS 127 Query: 369 RP*HPECP 392 P P P Sbjct: 128 PPPTPSLP 135 Score = 33.1 bits (72), Expect = 0.21 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 6/72 (8%) Frame = +3 Query: 186 PSMPYVVP--PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 PS P + P P P+P ++PSPPPT PPPA S P+ P P Sbjct: 108 PSPPSLTPFVPHPTP----KKSPSPPPTPS----LPPPAPKKSPSTPSLPPPTPKKSPPP 159 Query: 360 ----HDSRP*HP 383 H S P +P Sbjct: 160 PPSHHSSSPSNP 171 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 1/84 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASS-GGTSLP 320 P + I P + + PS P PP P+P SPPP T +PP + P Sbjct: 71 PAISISPSTPIPSTPSTPS--PPPPAP------KKSPPPPTPKKSPSPPSLTPFVPHPTP 122 Query: 321 TETGALPHTDTTPHDSRP*HPECP 392 ++ + P T + P + P P Sbjct: 123 KKSPSPPPTPSLPPPAPKKSPSTP 146 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.5 bits (73), Expect = 0.16 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPH 344 PY PP P P + AP PPP + PPP S S P PH Sbjct: 7 PY--PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPH 54 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 198 YVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASS 302 Y PP P P+ Y Q P P PPP S Sbjct: 45 YPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPS 79 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +3 Query: 186 PSMPYVVPPQP---SPYGYTAQAPSPP 257 PS+P VPP P PY Y P PP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPPPPPP 53 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTE 326 P+ P PP P P Q SPPP+ +PPP SS + P + Sbjct: 12 PAPPPPSPPSP-PSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQ 57 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 204 VPPQPSPYG--YTAQAPSPPPTTGTACRTPPPASSGGTSL 317 +PP P G + + P PPP +PP SGG ++ Sbjct: 250 LPPPPGSMGTNWVSSPPPPPPGNWQPMPSPPAPVSGGANV 289 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 108 PSEXRECGEIAXPTM--IIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACR 281 PS+ +E P+ I P P P P+ S G ++ +P PP + + + Sbjct: 35 PSDNQETTSPPPPSSPDIAPPPQQQQESPPPPL---PENSSDGSSSSSPPPPSDSSSQSQ 91 Query: 282 TPPPASS 302 +PPP S+ Sbjct: 92 SPPPPST 98 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 186 PSMPYVVPPQPS-PYGYTAQAPSPPP 260 P PYV PP PS PY Y PSP P Sbjct: 428 PPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 PYV PP P PY Y PPP + PPP S Sbjct: 422 PYVYPPPPPPYVY------PPPPSPPYVYPPPPPS 450 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P P PP P PY Y + P PPP+ PPP Sbjct: 395 PPPPPPPPPPPPPYVYPS-PPPPPPSPPPYVYPPPP 429 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P P PP P P Y +P PPP + PPP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVV-PPQPSPYGYTAQAPSPP 257 P + PS PYV PP PSP Y PSPP Sbjct: 430 PPYVYPPPPSPPYVYPPPPPSPQPY--MYPSPP 460 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 33.1 bits (72), Expect = 0.21 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 9/78 (11%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT---T 356 PS + PP +P +P P+ T PP+ + S P+ T PHT + T Sbjct: 41 PSGSHGTPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHT-PTPHTPSHTPT 99 Query: 357 PH------DSRP*HPECP 392 PH S P HP P Sbjct: 100 PHTPPCNCGSPPSHPSTP 117 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +3 Query: 207 PPQPSPYGYTA--QAPSPPPTTGTACRTP----PPASSGGTSLPTETGALPHTDTTPHDS 368 P PSP +T PS PT T TP PP + G T + P T + P S Sbjct: 70 PSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPSTPSHPTPS 129 Query: 369 RP 374 P Sbjct: 130 HP 131 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 33.1 bits (72), Expect = 0.21 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 9/78 (11%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT---T 356 PS + PP +P +P P+ T PP+ + S P+ T PHT + T Sbjct: 41 PSGSHGTPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHT-PTPHTPSHTPT 99 Query: 357 PH------DSRP*HPECP 392 PH S P HP P Sbjct: 100 PHTPPCNCGSPPSHPSTP 117 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +3 Query: 207 PPQPSPYGYTA--QAPSPPPTTGTACRTP----PPASSGGTSLPTETGALPHTDTTPHDS 368 P PSP +T PS PT T TP PP + G T + P T + P S Sbjct: 70 PSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPSTPSHPTPS 129 Query: 369 RP 374 P Sbjct: 130 HP 131 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/35 (54%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +3 Query: 219 SPYGYTAQAPSPPP--TTGTACRTPP-PASSGGTS 314 SP + PSPPP T TAC PP P SSGG S Sbjct: 44 SPVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGS 78 Score = 31.9 bits (69), Expect = 0.48 Identities = 26/80 (32%), Positives = 32/80 (40%), Gaps = 7/80 (8%) Frame = +3 Query: 186 PSMPYVV-PPQPSPY---GYTAQAPSPPPTTGTACRTPPPASSGGTSL---PTETGALPH 344 PS P PP PSP G ++ PP +G + PPP GG P +G P Sbjct: 58 PSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNYP- 116 Query: 345 TDTTPHDSRP*HPECPYRLH 404 TP P P P+ H Sbjct: 117 ---TPPPPNPIVPYFPFYYH 133 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 189 SMPYVVPPQPS-PYGYTAQAPSPPPT-TGTACRTPPPASSGGTS 314 S P PP PS P PSPP + G++ PPP+ SGG S Sbjct: 49 SPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGS 92 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 307 PPDEAGGGVLHAVPVVGGGEGACAVYPYGDGW 212 PP ++GGG + P GGG+G PY + Sbjct: 84 PPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNY 115 >At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 Pfam PF00400: WD domain, G-beta repeats; Length = 1327 Score = 32.7 bits (71), Expect = 0.28 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +3 Query: 132 EIAXPTMIIEP--QLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 E+A P + EP L + A PS P S A A SP P T +P P ++ Sbjct: 1153 EVAKPLALEEPTKPLAIEAPPSSE--APQTESAPETAAAAESPAPETAAVAESPAPGTAA 1210 Query: 306 GTSLP-TETGALP 341 P +ET A P Sbjct: 1211 VAEAPASETAAAP 1223 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL--PTETGA 335 P+ A P +P TA AP P T T PPP TSL ++ + Sbjct: 1195 PETAAVAESPAPGTAAVAEAPASETAAAPVDGPVTETVSE-PPPVEKEETSLEEKSDPSS 1253 Query: 336 LPHTDT 353 P+T+T Sbjct: 1254 TPNTET 1259 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.7 bits (71), Expect = 0.28 Identities = 24/80 (30%), Positives = 31/80 (38%), Gaps = 5/80 (6%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS--PPPTTGTACRTPPPASSGG 308 ++ P + + P T P P V PP P Y P+ PP T+ T PP S Sbjct: 92 VSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPP 151 Query: 309 TSLPT---ETGALPHTDTTP 359 PT T + TTP Sbjct: 152 VQPPTYKPPTSPVKPPTTTP 171 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 32.7 bits (71), Expect = 0.28 Identities = 17/62 (27%), Positives = 23/62 (37%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPE 386 PP P + +PPP + PP + TS PT + P P P +P Sbjct: 32 PPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPS 91 Query: 387 CP 392 P Sbjct: 92 PP 93 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/66 (22%), Positives = 23/66 (34%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P + P + P P+P P+ P ++ P P + S P G+ P Sbjct: 41 PSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTP 100 Query: 342 HTDTTP 359 T P Sbjct: 101 VTPPAP 106 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 32.7 bits (71), Expect = 0.28 Identities = 20/68 (29%), Positives = 29/68 (42%) Frame = +3 Query: 180 AGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 +GPS+ V P P GY + PP + PPP++SG +P+ P + P Sbjct: 167 SGPSLYPQVQQYPQPSGYPPASGYPPQPSA----YPPPSTSGYPPIPSAYPPPPPSSAYP 222 Query: 360 HDSRP*HP 383 P P Sbjct: 223 PQPYPPQP 230 >At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 161 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +3 Query: 195 PY-VVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSR 371 PY V+ P PY P ++ + PPP G + PT G LP+ P + Sbjct: 23 PYLVISDTPCPYPCYPTPPIGGGSSTPSMTQPPPYPPPGVNYPTPAGNLPNY-PPPVGNI 81 Query: 372 P*HPECPY 395 P +P PY Sbjct: 82 PNYPSPPY 89 >At5g41580.1 68418.m05052 zinc finger (MIZ type) family protein contains Pfam domain PF02891: MIZ zinc finger Length = 703 Score = 32.3 bits (70), Expect = 0.37 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 7/115 (6%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAPSP---PPTTGTACRTPPPA---SSGGTSLPTETGALPHTDT 353 +P + P P P ++ Q PSP P TT T P P+ S S T TG T Sbjct: 460 IPMSIDPMPVPVPFS-QTPSPRDRPATTSTVFTIPNPSPQYSQVHASPVTPTGTYLGRTT 518 Query: 354 TPHDSRP*HPECPYRLHKNFSLDKKI*IMLLSTCNFHTF-PSNNIPLYMENLNNF 515 +P ++ + P S + + S N +F S ++P + NN+ Sbjct: 519 SPRWNQTYQSQAPPMTTPYTSRKVSVPVTSQSPANVSSFVQSQHVPRVLSQPNNY 573 >At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 Length = 278 Score = 32.3 bits (70), Expect = 0.37 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +3 Query: 171 MLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT--SLPTETGALPH 344 M P + + P P PY + A P P P + P PA+ + S +T P Sbjct: 167 MPIVAPGLSLAIFPPPPPYVHVA--PYPTPMDASVVPAPGPAADDNSPDSAVPKTPPAPA 224 Query: 345 TDTTPHDS 368 TDT DS Sbjct: 225 TDTPEADS 232 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + PP P P Q P PPP+ A PPP Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 31.9 bits (69), Expect = 0.48 Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +3 Query: 210 PQPSPYGYTAQAP--SPPPT-TGTACRTPPPA-SSGGTSLPTETGALPHTDTTPHDSRP* 377 P PSP P +PPP T TPPPA S TS P + P +D P S P Sbjct: 24 PAPSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSD-APTASPP- 81 Query: 378 HPECP 392 PE P Sbjct: 82 APEGP 86 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 237 AQAPSPPPTTGTA---CRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 AQAP+P PTT TPPPA++ + P ++P S P Sbjct: 21 AQAPAPSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAP 69 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/76 (27%), Positives = 28/76 (36%), Gaps = 4/76 (5%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSM---PYVVPPQPSPYGYTAQAPSPPPTTGTACRTP-PPASSGGT 311 PT + P + T P+ P PP T+ PS P+ + T PPA G Sbjct: 28 PTTTVTPPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAPEGPG 87 Query: 312 SLPTETGALPHTDTTP 359 P E P + P Sbjct: 88 VSPGELAPTPSDASAP 103 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P+ PP PSPY + Q P PP TP P Sbjct: 61 PHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASS 302 P +P PQ PY + PPPT + PPP S Sbjct: 284 PQLPNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQS 322 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 T PS P PP P Q P+PPP+ + +P P + S P Sbjct: 45 TQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPNIACKSTP 92 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 S P PP P Q PS PPT TPPP+ S P Sbjct: 41 SQPPTQPPSQPPTQPPTQPPSHPPTQPP---TPPPSQSPSQPSP 81 >At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / caspase family protein contains similarity to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam profile PF00656: ICE-like protease (caspase) p20 domain Length = 418 Score = 31.9 bits (69), Expect = 0.48 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSP----PPTTGTACRTPPPAS 299 PS PP PSPY + APSP PP + PP +S Sbjct: 58 PSTFIYPPPTPSPYTHAPHAPSPFNHAPPDSYPFTHAPPASS 99 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 31.9 bits (69), Expect = 0.48 Identities = 19/72 (26%), Positives = 24/72 (33%) Frame = +3 Query: 165 QLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPH 344 QL P MP VV P P G+T A +PP + + P P Sbjct: 923 QLGQYPNPKMPQVVAPAAGPIGFTPMATPGVAPRSVQPASPPTQQAAAQAAPAPATPPPT 982 Query: 345 TDTTPHDSRP*H 380 T + P H Sbjct: 983 VQTADTSNVPAH 994 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 31.9 bits (69), Expect = 0.48 Identities = 19/72 (26%), Positives = 24/72 (33%) Frame = +3 Query: 165 QLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPH 344 QL P MP VV P P G+T A +PP + + P P Sbjct: 925 QLGQYPNPKMPQVVAPAAGPIGFTPMATPGVAPRSVQPASPPTQQAAAQAAPAPATPPPT 984 Query: 345 TDTTPHDSRP*H 380 T + P H Sbjct: 985 VQTADTSNVPAH 996 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/63 (31%), Positives = 23/63 (36%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPE 386 P SP + P P +PPPASS TS P + P P P P Sbjct: 421 PYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESP-QPN 479 Query: 387 CPY 395 PY Sbjct: 480 DPY 482 >At1g80070.1 68414.m09373 splicing factor, putative strong similarity to splicing factor Prp8 [Homo sapiens] GI:3661610; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 2382 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 246 PSPPPTTGTACRTPPPASS-GGTSLPTETGALPHTDTTPHDS 368 P PP TG + PPPA+ T+LP + P + TP ++ Sbjct: 9 PLAPPGTGGSMMPPPPAAHPSYTALPPPSNPTPPVEPTPEEA 50 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 292 GGGVLHAVPVVGGGEGACAVYPYGDGWGGTTYGIDG 185 GGG + ++GGG G C G G GG YG G Sbjct: 168 GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 31.5 bits (68), Expect = 0.64 Identities = 22/69 (31%), Positives = 27/69 (39%) Frame = +3 Query: 168 LMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHT 347 + +T S P PP+P P A AP+PP T TPP PT P Sbjct: 15 ISITIVSSAPAPKPPKPKP----APAPTPPKPKPTPAPTPPKPKP--KPAPTPPKPKPAP 68 Query: 348 DTTPHDSRP 374 TP +P Sbjct: 69 APTPPKPKP 77 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 P PP+P P A AP+PP TPP PT P TP +P Sbjct: 57 PAPTPPKPKP----APAPTPPKPKPAPAPTPPKPKP--KPAPTPPNPKPTPAPTPPKPKP 110 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P PP+P P A AP+PP TPP P + P TP Sbjct: 68 PAPTPPKPKP----APAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 >At5g27870.1 68418.m03343 pectinesterase family protein similar to pectinesterase (EC 3.1.1.11) from Salix gilgiana GI:6714532, Lycopersicon esculentum SP|Q43143, Phaseolus vulgaris SP|Q43111; contains Pfam profile PF01095 pectinesterase Length = 732 Score = 31.5 bits (68), Expect = 0.64 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 10/98 (10%) Frame = +3 Query: 105 TPSEXRECGEIAXPT----MIIEPQLMLTAG-----PSMP-YVVPPQPSPYGYTAQAPSP 254 TPS G + P+ ++ P L AG P+ P VV P SP +PS Sbjct: 594 TPSTSPPAGHLGSPSDTPSSVVSPSTSLPAGQLGAPPATPSMVVSPSTSPPAGHLGSPSD 653 Query: 255 PPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 P++ + T PPA G+ P++T P + TP S Sbjct: 654 TPSSLVSPSTSPPAGHLGS--PSDT---PSSVVTPSAS 686 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.5 bits (68), Expect = 0.64 Identities = 23/64 (35%), Positives = 26/64 (40%), Gaps = 5/64 (7%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTAC-----RTPPPASSGGTSLPTETGALPHTDTTPHDSR 371 PP P P +PP TT TA R+PPP PT T + T T H R Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHR 179 Query: 372 P*HP 383 P P Sbjct: 180 PPPP 183 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP-PASSGGTSLPTETGAL 338 P L TAG P P+ G+ ++P PP T R PP PA++ G ++ Sbjct: 13 PPLATTAGHHRR---SPPPATTGHHHRSP-PPAITACHHRRPPLPATTAGHHRQLRPPSI 68 Query: 339 PHTDTTPH 362 P T T H Sbjct: 69 PVTTNTGH 76 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 PYV P PY Y SPPP+ + +PPP Sbjct: 403 PYVYS-SPPPYVYNPPPSSPPPSPSYSYSSPPP 434 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/87 (27%), Positives = 35/87 (40%), Gaps = 3/87 (3%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQA---PSPPPTTGTACRTPPPASSGGTS 314 P + P + ++ P PY P PSPY Y + SPPP +PPP + Sbjct: 165 PYVYKSPPYVYSSPP--PYAYSPPPSPYVYKSPPYVYSSPPP----YAYSPPPYAYSPPP 218 Query: 315 LPTETGALPHTDTTPHDSRP*HPECPY 395 P + P+ ++P P PY Sbjct: 219 SPYVYKSPPYVYSSPPPYAYSPPPSPY 245 Score = 29.1 bits (62), Expect = 3.4 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 7/91 (7%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQA---PSPPPTTGTA----CRTPPPASS 302 P + P + ++ P PY P PSPY Y + SPPP ++ +PPP + Sbjct: 102 PYVYKSPPYVYSSPP--PYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAY 159 Query: 303 GGTSLPTETGALPHTDTTPHDSRP*HPECPY 395 P + P+ ++P P PY Sbjct: 160 SPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 190 >At3g23270.1 68416.m02933 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1); similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to chromosome condensation regulator protein (GI:22770461) [Cicer arietinum] Length = 1045 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTG 269 P L GPS P PP S Y A+ PSPP T+G Sbjct: 759 PPRTLVIGPSSPSPPPPPRSSSPY-ARRPSPPRTSG 793 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGT--ACRTPPPASSG 305 P PP+ G ++ +P PPP + + A R PP +SG Sbjct: 755 PTTTPPRTLVIGPSSPSPPPPPRSSSPYARRPSPPRTSG 793 >At3g22620.1 68416.m02856 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 203 Score = 31.5 bits (68), Expect = 0.64 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = +3 Query: 177 TAGPSM---PYVVP--PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG-TSLPTET 329 T GPSM P P P+P+P T Q+ + P T + P + GG TS P+ET Sbjct: 123 TFGPSMSPGPETDPIVPEPTPAAQTPQSDTTRPFTPSVDGGAPTSDDGGSTSRPSET 179 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG-ALPHTDTTPHDSRP*HP 383 PP S + YT P + PPP SS P + P + H S P +P Sbjct: 164 PPVSSSHVYTNPMDIPSDFSSATTNYPPPQSSEANFYPPLSSIGYPPSSPPQHYSSPPYP 223 Query: 384 -ECPYRLHKNF 413 PY+ H ++ Sbjct: 224 YPNPYQYHSHY 234 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 8/73 (10%) Frame = +3 Query: 180 AGPSMPYVVP--PQPSPYGYTAQAPS------PPPTTGTACRTPPPASSGGTSLPTETGA 335 + P Y P P P+PY Y + P PPP + PPP S TS P Sbjct: 211 SSPPQHYSSPPYPYPNPYQYHSHYPEQPVAVYPPPPPSASNLYPPPYYS--TSPPQHQSY 268 Query: 336 LPHTDTTPHDSRP 374 P + H ++P Sbjct: 269 PPPPGHSFHQTQP 281 >At1g69295.1 68414.m07947 beta-1,3-glucanase-related low similarity to elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum] GI:11071974 Length = 222 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 G + P PP + T + S PTTGT P + + T PT TG P T T Sbjct: 87 GAASPSTTPPSTASNCLTGSSSSGTPTTGTPTTGTPTSGTPTTGTPT-TGT-PTTGT 141 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 31.5 bits (68), Expect = 0.64 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 6/81 (7%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS 314 I+ P +P + S P V QP PPPT + C + PPA+S S Sbjct: 515 ISQPPTTSKPFVSQPPNTSKPMPVS-QPPTTSKPLPVSQPPPTFQSTCPSQPPAASSSLS 573 Query: 315 -LP-----TETGALPHTDTTP 359 LP T++ P TTP Sbjct: 574 PLPPVFNSTQSFQSPPVSTTP 594 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/82 (23%), Positives = 34/82 (41%) Frame = +3 Query: 135 IAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS 314 ++ P +P + P+ P QP P ++ +P PP T PP S+ ++ Sbjct: 538 VSQPPTTSKPLPVSQPPPTFQSTCPSQP-PAASSSLSPLPPVFNSTQSFQSPPVSTTPSA 596 Query: 315 LPTETGALPHTDTTPHDSRP*H 380 +P E +P ++P H Sbjct: 597 VP-EASTIPSPPAPAPVAQPTH 617 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 PS P PP P+ A P PP + C PPPA+ Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPAN 99 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 31.1 bits (67), Expect = 0.85 Identities = 24/72 (33%), Positives = 27/72 (37%), Gaps = 8/72 (11%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTA------QAPSPPPTTG--TACRTPPPASSGGTSLPTETGAL 338 GP PY P PY Y A P PPP T +A P P T P + Sbjct: 5 GPRYPYPYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPP 64 Query: 339 PHTDTTPHDSRP 374 PH T+ S P Sbjct: 65 PHQHTSGSHSGP 76 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +3 Query: 210 PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 P P Y Y A PPP T PPP + G L T T HD+ Sbjct: 120 PPPPHYSYQEPAQYPPPETKPQEPLPPPQQTQGFQEYRRQDCL-STGGTGHDN 171 >At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical to gi|3883122|gb|AAC77824; supported by cDNA gi|3883121|gb|AF082299 Length = 131 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 237 AQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 AQAP+P PTT T T P + T P + +P + TP Sbjct: 21 AQAPAPAPTTVTPPPTALPPVTAETPSPIASPPVPVNEPTP 61 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 189 SMPYVVPPQPS-PYGYTAQAPSPPPTTGTACRTP-PPASSGGTSLPTETG 332 S P PP P+ P G ++ +P P T+ A + P PP SS + P G Sbjct: 29 SPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPSQG 78 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/72 (30%), Positives = 26/72 (36%), Gaps = 6/72 (8%) Frame = +3 Query: 186 PSMPYVVPPQ------PSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHT 347 PS P PPQ P P + AP P ++ +P P S GG G Sbjct: 33 PSPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPSQGGGGERGNGGNNGGN 92 Query: 348 DTTPHDSRP*HP 383 DT P P P Sbjct: 93 DTPPSRGSPPSP 104 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +3 Query: 189 SMPYVVPP-----QPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG-ALPHTD 350 S P PP PSP T S PP TPP S + P T P Sbjct: 3 SSPESAPPTNSTSSPSPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPPAPQAP 62 Query: 351 TTPHDS 368 P+ S Sbjct: 63 NPPNSS 68 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 P + Y + +P P PT T TPP SSG Sbjct: 1502 PQKILSYAFPEISPKPDPTLSTTASTPPATSSG 1534 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 31.1 bits (67), Expect = 0.85 Identities = 24/78 (30%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSM-PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP 320 P I P L T PS P P PSP +A P PTT PP S Sbjct: 26 PAPTISP-LPATPTPSQSPRATAPAPSP---SANPPPSAPTTAPPVSQPPTESPPAPPTS 81 Query: 321 TETGALPHTDTTPHDSRP 374 T P T+ ++ P Sbjct: 82 TSPSGAPGTNVPSGEAGP 99 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 237 AQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 AQAP P PT TP P+ S P T P P S P Sbjct: 21 AQAPGPAPTISPLPATPTPSQS-----PRATAPAPSPSANPPPSAP 61 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 30.7 bits (66), Expect = 1.1 Identities = 27/83 (32%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +3 Query: 159 EPQLMLTAGPSMPYVV-PPQPSP----YGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 +P GP PY + PP P P YG Q P P G R PPP G P Sbjct: 164 QPPFAGQGGPPPPYGMRPPYPGPPPPQYG-GQQRPMMIPPPGGMMRGPPP-PHGMQGPPP 221 Query: 324 ETGALPHTDTTPHDSRP*HPECP 392 +P P + P HP P Sbjct: 222 SRPGMPPPGGAPMFAPP-HPGMP 243 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 132 EIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPP 260 +I+ P II P + P P P PYG P PPP Sbjct: 147 QISRPPQIIRPPGQMPPQPPFAGQGGPPP-PYGMRPPYPGPPP 188 >At2g35530.1 68415.m04352 bZIP transcription factor family protein contains Pfam domain PF00170: bZIP transcription factor; similar to G-Box binding protein 2 (GI:5381313) [Catharanthus roseus]. Length = 409 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/88 (28%), Positives = 32/88 (36%), Gaps = 7/88 (7%) Frame = +3 Query: 159 EPQLMLTAGPSMP-----YVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 EP ++AG + P P P P+GY A +P P P PP GT Sbjct: 30 EPSSAVSAGMATPDWSGFQAYSPMPPPHGYVASSPQPHPYMWGVQHMMPPY---GTPPHP 86 Query: 324 ETGALPHTDTTPHDSRP--*HPECPYRL 401 P H S P +P PY + Sbjct: 87 YVAMYPPGGMYAHPSMPPGSYPYSPYAM 114 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/65 (30%), Positives = 26/65 (40%) Frame = +3 Query: 174 LTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 L+ PS P PP SP + + SP P + + PP SS S P P + Sbjct: 61 LSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPP--SSLSPSSPPPLSLSPSSPP 118 Query: 354 TPHDS 368 P S Sbjct: 119 PPPPS 123 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 PS P P P + +P P + ++ PPP+SS +SL + + +++ T D Sbjct: 87 PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSSSSSTYSNQTNLD 146 >At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to SP|P11035 Nitrate reductase 2 (formerly EC 1.6.6.1) (NR2) {Arabidopsis thaliana} Length = 917 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 196 GIDGPAVSMSCGSIIMVGFAISPH 125 G+DG A++M+CG M+ FA+ P+ Sbjct: 879 GLDGSALAMACGPPPMIQFAVQPN 902 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +3 Query: 186 PSMPYVVPPQ---PSPYGYTAQA-PSPPPTTGTACRTPPPASSGGTSLPTETGALP 341 P Y PPQ P P GY Q P PP A PPP + P +G P Sbjct: 25 PPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/54 (29%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVV----PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P + P +T P P + PP+P Y + P PPP PPP Sbjct: 156 PVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPP 209 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTAC-RTPPP 293 PP P YG P PPP + R+PPP Sbjct: 195 PPPPYKYGRVYPPPPPPPQAARSYKRSPPP 224 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVV---PPQP---SPYGYTAQAPSPPPTTGTACRTPPP 293 P ++ P + P P V+ PP P SP T P PPP T R+PPP Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP---TITRSPPP 181 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 +P V+PP P A PPPT A PPP Sbjct: 457 IPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPP 490 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 +P V+PP P A PPPT A PPP Sbjct: 457 IPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPP 490 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 +P V+PP P A PPPT A PPP Sbjct: 457 IPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPP 490 >At3g20570.1 68416.m02604 plastocyanin-like domain-containing protein Length = 203 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGA 335 PP P+P APS PP +GT TP P + P + Sbjct: 142 PPSPAPAPSGESAPS-PPVSGTFEMTPAPTPTTSEDTPNSAAS 183 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP 374 P P P P P P + TA + PP+S LPT+ + P+ P Sbjct: 235 PTAQSPAPVPMQQFPLTSFPQPPSSTAAPSQPPSSQLPPQLPTQFS----SQQEPYCPPP 290 Query: 375 *HPECP 392 HP+ P Sbjct: 291 SHPQPP 296 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 5/74 (6%) Frame = +3 Query: 105 TPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVP-----PQPSPYGYTAQAPSPPPTTG 269 TP R G + ++ A P+ P P P+ P G + +P P G Sbjct: 108 TPGHCRTNGGMKLAVNVVAGSAGPPATPTPPSSTPGTPTTPESPPSGGSPTPTTPTPGAG 167 Query: 270 TACRTPPPASSGGT 311 + PPP +SG + Sbjct: 168 STSPPPPPKASGAS 181 >At5g24620.1 68418.m02908 thaumatin-like protein, putative similar to thaumatin-like protein [Arabidopsis thaliana] GI:2435406; contains Pfam profile PF00314: Thaumatin family Length = 420 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 201 VVPPQPSPYGYTAQAPSPPPT-TGTACRTPPPASSGG 308 + PP + YG P+PPP TPPP + G Sbjct: 324 LAPPTQNQYGQPMAPPTPPPPGPNEDSMTPPPQNQNG 360 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTT-GTACRTPPPASS 302 P P PPQ Y +P PPP+ G PPP S Sbjct: 50 PPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPPGKS 89 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 204 VPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 +PP P P +AP PPP R PPP Sbjct: 29 LPPPPPPPLMRRRAPPPPPPPLMRRRAPPP 58 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 5/77 (6%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSP-YGYTAQAPSPPPTTGTACRTPP--PASSGG-- 308 P + P L A P+ +PP P+P + +AQ S P P P SSGG Sbjct: 195 PVPVSTPPSQLQAPPAQSQFMPPPPAPSHPSSAQTQSFPQYQQNWPPQPQARPQSSGGYP 254 Query: 309 TSLPTETGALPHTDTTP 359 T P G P ++ P Sbjct: 255 TYSPAPPGNQPPVESLP 271 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 5/77 (6%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSP-YGYTAQAPSPPPTTGTACRTPP--PASSGG-- 308 P + P L A P+ +PP P+P + +AQ S P P P SSGG Sbjct: 253 PVPVSTPPSQLQAPPAQSQFMPPPPAPSHPSSAQTQSFPQYQQNWPPQPQARPQSSGGYP 312 Query: 309 TSLPTETGALPHTDTTP 359 T P G P ++ P Sbjct: 313 TYSPAPPGNQPPVESLP 329 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +3 Query: 129 GEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASS 302 G + P ++ P M+T P MP PP P AP P P P++S Sbjct: 45 GGSSVPPPVMSPMPMMTP-PPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTS 101 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 PS+P P P+P T PSP PT T RT P SSG Sbjct: 57 PSVP--TPSVPTPSVPTPSVPSPNPTPVTPPRT--PGSSG 92 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTA---QAPSPPPTTGTACRTPPPASSGGTSL 317 P +PY PP P + Y A Q PS P T G+ P + TS+ Sbjct: 282 PGVPYGRPPMPGGFPYGAPPQQLPSAPGTPGSIYGMGPMQNQSMTSV 328 >At3g27320.1 68416.m03414 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 460 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/65 (26%), Positives = 29/65 (44%) Frame = +3 Query: 120 RECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 R IA ++ + ++ + + V + + YGYT + SP + R P+S Sbjct: 99 RTLNNIAGSDLLSRRNSLGSSNSLLSHKVESRRNSYGYTTGSSSPEAGSSDVYRGYAPSS 158 Query: 300 SGGTS 314 SGG S Sbjct: 159 SGGNS 163 >At3g10720.2 68416.m01291 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 619 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 6/80 (7%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQA----PSPPPTTGTACRTP--PPASSGGTSLPTETGALPHT 347 PS P+ PP P+ ++ PS PP + P PP+ S SL ++ P Sbjct: 32 PSQPHSEPPSQLPFEPPVESPFFPPSQPPIFVPPSQPPSLPPSQSQSPSLACKSTPYPKL 91 Query: 348 DTTPHDSRP*HPECPYRLHK 407 T ++ P PYR K Sbjct: 92 CRTILNAVKSSPSDPYRYGK 111 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGG 308 PS PQ S GY +Q +PPP T P PASS G Sbjct: 56 PSPASSYGPQYSQEGYASQPNNPPPP--TYAPAPSPASSYG 94 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 PP PSP PS PT+ TA PPPA SLPT Sbjct: 89 PPPPSPPHPNPFFPSSDPTS-TASH-PPPAPPPPASLPT 125 >At2g40820.1 68415.m05038 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 903 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/66 (28%), Positives = 24/66 (36%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P M P PY P PPP T P S +S+P P +T P Sbjct: 746 PPMTNTNPQMQQPYYPPPMQPPPPPMNSGYMPTYIPKSVNDSSMPNP----PMNNTNPQM 801 Query: 366 SRP*HP 383 +P +P Sbjct: 802 QQPYYP 807 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = +3 Query: 180 AGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 A S P V PQP A +P PP ++ A PASS ++ + P P Sbjct: 94 APSSSPEVDSPQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQP 153 Query: 360 HD-SRP*HPE 386 S P +PE Sbjct: 154 ESPSSPSYPE 163 >At2g23990.2 68415.m02866 plastocyanin-like domain-containing protein Length = 226 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG 332 P P P P+P T PSP +T T P PA S L G Sbjct: 165 PPKPSTTPAAPAPAPPT---PSPKSSTSTMAPAPAPAKSSAVGLVAGNG 210 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 210 PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P+P P T P P TT A PP S +S T Sbjct: 153 PKPGPAAVTPTLPPKPSTTPAAPAPAPPTPSPKSSTST 190 >At2g23990.1 68415.m02865 plastocyanin-like domain-containing protein Length = 207 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG 332 P P P P+P T PSP +T T P PA S L G Sbjct: 146 PPKPSTTPAAPAPAPPT---PSPKSSTSTMAPAPAPAKSSAVGLVAGNG 191 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 210 PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P+P P T P P TT A PP S +S T Sbjct: 134 PKPGPAAVTPTLPPKPSTTPAAPAPAPPTPSPKSSTST 171 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPT-TGTACRTPPPASSGGTSLPTETGALPHTDTTPH 362 PS + P+ T+ SPPP+ + R+PPP SS +SLP +T + P T P Sbjct: 204 PSYAKIFTPKCLLRFQTSVLLSPPPSPSAPPPRSPPPKSSPPSSLP-QTPSPPLVFTPPQ 262 Query: 363 D 365 + Sbjct: 263 N 263 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 9/58 (15%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPP---------TTGTACRTPPPASSGGTSLPTETG 332 P PP P P PSPPP + +A + PPPA G +S + G Sbjct: 252 PVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRGSSSGESSNG 309 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAP---SPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 P PYV P PY + P SPPP + PPP S + ++ P+ ++ Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSS 768 Query: 357 P 359 P Sbjct: 769 P 769 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = +3 Query: 186 PSMPYVVPPQPSPY---GYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 P PYV P PY + SPPP + PPP S + ++ P+ ++ Sbjct: 760 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSS 819 Query: 357 P 359 P Sbjct: 820 P 820 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPAS 299 P + P + Y PP P Y + PS P+ ++PPP S Sbjct: 848 PPAYYSPSPKIEYKSPPPPYVYS-SPPPPSYSPSPKAEYKSPPPPS 892 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTP 287 T P P + P P P A +PSPP + GT ++P Sbjct: 105 TQTPETPPAITPLPVPLA-PAPSPSPPVSPGTTKKSP 140 >At5g54830.1 68418.m06829 DOMON domain-containing protein / dopamine beta-monooxygenase N-terminal domain-containing protein contains Pfam PF03351: DOMON domain Length = 907 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 168 LMLTAGPSMPYVVPPQPSPYGYTAQAPSP 254 L++TAGPS+ Y PP PS Y + +P Sbjct: 391 LVVTAGPSVHYPNPPNPSKVLYINKKEAP 419 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 165 QLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 +L+ T P PP P PY P PPP PPP Sbjct: 28 KLLQTTTNYQPIYSPP-PPPYRSPVTIPPPPPVYSRPVAFPPP 69 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P P PP P Y +P PPP +PPP Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 >At5g04885.1 68418.m00512 glycosyl hydrolase family 3 protein contains Pfam profiles PF00933: Glycosyl hydrolase family 3 N terminal domain, PF01915: Glycosyl hydrolase family 3 C terminal domain Length = 665 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -2 Query: 277 HAVPVVGGGE--GACAVYPYGDGWGGTTYGID 188 H VP VGG + ACA + GD GGTT G++ Sbjct: 215 HGVPFVGGRDKVAACAKHYVGD--GGTTRGVN 244 >At4g30260.1 68417.m04302 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 280 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/80 (25%), Positives = 28/80 (35%), Gaps = 4/80 (5%) Frame = +3 Query: 138 AXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQ----APSPPPTTGTACRTPPPASSG 305 A P I P + +++ P + +PP P + Q P+PPP Sbjct: 38 ARPPSPIRPSIPVSSSPFVQSNLPPLPPSSSSSTQKVMPVPAPPPLPSAGNEGNKSIGGS 97 Query: 306 GTSLPTETGALPHTDTTPHD 365 G P T P DT D Sbjct: 98 GFGSPPNTLTEPVWDTVKRD 117 >At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 487 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP--TETG 332 P L P + PP P+ G P PP TG+ TP ++GG P ETG Sbjct: 411 PPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTGSYI-TPSNTTAGGFQYPNGAETG 468 >At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP--TETG 332 P L P + PP P+ G P PP TG+ TP ++GG P ETG Sbjct: 411 PPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTGSYI-TPSNTTAGGFQYPNGAETG 468 >At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLP--TETG 332 P L P + PP P+ G P PP TG+ TP ++GG P ETG Sbjct: 411 PPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTGSYI-TPSNTTAGGFQYPNGAETG 468 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSP--PPTTGTACRTPPP 293 P PYV P PY Y + P P P+ ++PPP Sbjct: 331 PPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPP 368 Score = 28.3 bits (60), Expect = 6.0 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 11/77 (14%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQP------SPYGYTAQAP-----SPPPTTGTACRTPPPASSGG 308 PQL + P + Y PP P P Y + +P SPPP + PPP S Sbjct: 109 PQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPS 168 Query: 309 TSLPTETGALPHTDTTP 359 + ++ P+ ++P Sbjct: 169 PKVDYKSPPPPYVYSSP 185 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/68 (33%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 138 AXPTMIIEPQLMLT--AGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGT 311 A PT I P T A P+ V PP SP +A P+ PPT+ T P +G T Sbjct: 43 AAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPPA-PPTSLTPDGAPVAGPTGST 101 Query: 312 SLPTETGA 335 + A Sbjct: 102 PVDNNNAA 109 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 +A P +P PP P P P PPP G PPP + G Sbjct: 669 SARPPLPGGGPPPPPPP--PGGGPPPPPGGGPPPPPPPPGALG 709 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSP-PPTTGTACRTPPPASSGGTSLPTETGALP 341 PP+ + G + PS PP G PPP GG P G P Sbjct: 655 PPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPP 700 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPA 296 P I+ P + P+ P P P P T AP PPP+T PPPA Sbjct: 102 PAPIVNPNPPPPSTPNPPPEFSP-PPPDLDTTTAP-PPPSTDIPIPPPPPA 150 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP----PASSGG-TSLPTET 329 GP++P +PP P +PP T G C PP P S GG + P +T Sbjct: 161 GPNLP--LPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPPSGGGKATCPIDT 212 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +3 Query: 183 GPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP----PASSGG-TSLPTET 329 GP++P +PP P +PP T G C PP P S GG + P +T Sbjct: 161 GPNLP--LPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPPSGGGKATCPIDT 212 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 132 EIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPP 257 +I P ++ + + P PY PP PS ++ PSPP Sbjct: 238 QIFTPKCLLRYEATALSSPPPPYPSPPPPSSPLFSPLLPSPP 279 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 S+PY+ + G T P+ PP TG A + PP SS T +P+ Sbjct: 69 SVPYIQTNKILTSGSTQPQPNAPPMTGFA-TSGPPFSSPYTFVPS 112 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETG---ALPHT--D 350 P P PPQPS +A +PS ++G CR + G+++ ++ G A P + Sbjct: 218 PLPPLAKPPQPSDNSPSALSPS-SSSSGEECRDTAFYTPHGSAISSDDGYYTAFPRSANG 276 Query: 351 TTPHDSR 371 + PH R Sbjct: 277 SLPHSKR 283 >At4g24660.1 68417.m03530 zinc finger homeobox family protein / ZF-HD homeobox family protein hypothetical protein T8K22.16, Arabidopsis thalianachromosome II BAC T8K22, PATX:G3184285 Length = 220 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = +3 Query: 198 YVVPPQP-SPYGY----TAQAP-SPPPTTGTACRTPPPASSGGTS 314 Y PPQP P GY + AP PP +G T P+SSGGT+ Sbjct: 113 YNRPPQPHQPPGYLHLTSPAAPYRPPAASGDEEDTSNPSSSGGTT 157 >At4g22540.1 68417.m03253 oxysterol-binding family protein similar to SP|P16258 Oxysterol-binding protein 1 {Oryctolagus cuniculus}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 721 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 219 SPYGYTAQAPSPPPTTG-TACRTPPPAS-SGGTSLPTETGAL 338 SP+G +Q+P P TT T R+ P S +GG+ T G L Sbjct: 16 SPHGINSQSPEEPVTTALTRSRSLPAKSLTGGSESETVAGIL 57 >At3g60270.1 68416.m06737 uclacyanin, putative similar to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain Length = 187 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 PS P P PSP + APSP P+ G A AS G Sbjct: 132 PSAPSPSPSAPSP---SPSAPSPSPSPGNAENLKNAASKG 168 >At3g04440.1 68416.m00470 expressed protein contains Pfam domain, PF04515: Protein of unknown function, DUF580 Length = 482 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTT 266 P + +PP SP+ + Q PPPTT Sbjct: 18 PRIMSPLPPSSSPFAFKEQQGRPPPTT 44 >At2g45000.1 68415.m05603 expressed protein contains Pfam profile: PF05064 Nsp1-like C-terminal region Length = 739 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 210 PQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP 359 P SP+G+ + S T ++ PASS T + GA P + +TP Sbjct: 136 PGSSPFGFVTSSASSTATPSSSL-FGAPASSAATPSSSPFGAAPASGSTP 184 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 P+ P + P P+P A A +P A +P PAS+ S P + P DT Sbjct: 41 PTSPAISPAAPTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPS---PEADT 93 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 P+ P + P P+P A A +P A +P PAS+ S P + P DT Sbjct: 41 PTSPAISPAAPTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPS---PEADT 93 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Frame = +3 Query: 186 PSMPYVVPP---QPSPYGYTA----QAPSPPPTTGTACRTPPPASSGGTSLPTET 329 P +P ++PP P P ++ PSPPP T +PP S + P E+ Sbjct: 65 PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNES 119 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGT--ACRTPPPASSGGTSLPTETGALPHTDTTP 359 PY PP PSP +P PPP+ + R PP ++G + P G P T +P Sbjct: 61 PYGNPPPPSP----QYSPPPPPSQSSPPRSRCPPVPTTGCCNQP--PGPPPSTMYSP 111 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPP 290 PS Y PP PS P PTTG C PP Sbjct: 68 PSPQYSPPPPPSQSSPPRSRCPPVPTTG-CCNQPP 101 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPP----PTTGTACRTPPPASSGGTSLPTETGALPHTDT 353 PS P PSP AQ+P+ P P + + +P P S S + A ++T Sbjct: 269 PSHSPATPKSPSPSSSPAQSPATPSPMTPQSPSPVSSPSPDQSAAPSDQSTPLAPSPSET 328 Query: 354 TP 359 TP Sbjct: 329 TP 330 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/69 (28%), Positives = 26/69 (37%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHD 365 P +P PP P + PSPP + PPP ++ LP P +P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSL--PPPPPAALFPPLPPPPSQPPPPPLSPPP 1119 Query: 366 SRP*HPECP 392 S P P P Sbjct: 1120 SPPPPPPPP 1128 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 28.7 bits (61), Expect = 4.5 Identities = 25/77 (32%), Positives = 28/77 (36%), Gaps = 1/77 (1%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTP-H 362 P P PP P P +PSP P PPP T P LP P H Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEH----YPPPPYHHYITPSPPPPRPLPPPPPPPLH 118 Query: 363 DSRP*HPECPYRLHKNF 413 S P + Y + KNF Sbjct: 119 FSSPLIKKV-YPVIKNF 134 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/76 (28%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = +3 Query: 210 PQPSPYGYTAQAPSP--PPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HP 383 P P P Y P P PP PPP+ S + +P RP P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPP 111 Query: 384 ECPYRLHKNFSLDKKI 431 P LH + L KK+ Sbjct: 112 PPPPPLHFSSPLIKKV 127 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTT----GTACRTPPP-ASSGGTSLPTETG 332 P P P Y+ P PPP++ G+ +PPP +SSGG P G Sbjct: 41 PCNPVPSSYSP--PPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYG 85 >At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 Length = 280 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 171 MLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG 305 ++ G P VPP P + P+P P G A P PA G Sbjct: 169 IVAPGLGSPVKVPPPPP----MSSPPAPSPKKGAATPAPAPADEG 209 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +3 Query: 189 SMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDS 368 S P + PP P P P+PP ++ P P S P ++ + P+++ P + Sbjct: 73 SYPGLSPP-PGPI----TLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPNPPVT 127 Query: 369 RP*HPE 386 P PE Sbjct: 128 VPNPPE 133 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 195 PYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 P +PP PSP + +P PPP + PPP Sbjct: 154 PESLPP-PSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 159 EPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 EP+ P P PP PSP PSPPP+ PPP Sbjct: 55 EPEPADCPPPPPPPPCPPPPSP-PPCPPPPSPPPSPPPPQLPPPP 98 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPP 290 PP PSP A PPP C PP Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPP 74 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPS-PPPTTGTACRTPPP 293 P+ I P + + P Y PP P Y S PPP+ +PPP Sbjct: 546 PSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 >At5g51800.1 68418.m06423 expressed protein Length = 972 Score = 28.3 bits (60), Expect = 6.0 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 6/94 (6%) Frame = +3 Query: 144 PTMIIEPQLMLTAGPSMP----YVVPPQPSPYGYTA-QAPSPPPTTGTACRTPPPASSGG 308 PT I P + P +P + SP + A +PS PT T +P P+++ Sbjct: 47 PTPIFIPTVSSPGAPVIPKRPRFSTSSGLSPPQWKALPSPSTVPTASTISSSPTPSTAVV 106 Query: 309 TSLPTET-GALPHTDTTPHDSRP*HPECPYRLHK 407 T+ TET G+ P + + P+ HK Sbjct: 107 TASSTETAGSSPPGQEATNSEKQQQPKTESFQHK 140 >At5g29020.1 68418.m03592 hypothetical protein Length = 847 Score = 28.3 bits (60), Expect = 6.0 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +3 Query: 222 PYGYTAQAPSPP-PTTGTACRTPPPASSGGTS-LPTE-TGALPHTDTTPHDSR 371 P G +PP PTTG R PP S G S PT+ +G L + P SR Sbjct: 31 PCGSRTLPVNPPYPTTGKRKRADPPKPSRGLSPNPTDPSGVLIQPPSNPSVSR 83 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/66 (34%), Positives = 28/66 (42%) Frame = +3 Query: 177 TAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTT 356 T P+ P V P P P Q PSP PTT + P P + P+ A P + Sbjct: 429 TPVPTTP-VHKPTPVPTT-PVQKPSPVPTTPV--QKPSPVPTTPVHEPSPVLATPVDKPS 484 Query: 357 PHDSRP 374 P SRP Sbjct: 485 PVPSRP 490 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/55 (27%), Positives = 19/55 (34%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTD 350 P + PP SP + P PP ++PPPA P P D Sbjct: 622 PPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDD 676 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +3 Query: 216 PSPYGYTA--QAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSRP*HPEC 389 P PY Y++ AP+P T+ ++ PPP SS G P D P ++ H + Sbjct: 317 PEPY-YSSPHSAPAPSSTSFSSAPPPPPYSSNG-----RINIAPVLDPAPSSAQKYHYDS 370 Query: 390 PYR 398 Y+ Sbjct: 371 SYQ 373 >At4g18400.1 68417.m02731 expressed protein Length = 107 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPA 296 PP PSP ++Q PPP T T T P+ Sbjct: 12 PPLPSPPESSSQPEHPPPETSTPPATFDPS 41 >At3g22440.1 68416.m02836 hydroxyproline-rich glycoprotein family protein identical to hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|9293881|dbj|BAB01784 Length = 532 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 189 SMPYVVPPQPSP-YGYTAQAPSPPPTTGTACRTPP 290 S P++ P SP Y A PSPP TT + R+PP Sbjct: 444 SFPFIRSPSHSPQYASPAAYPSPP-TTVYSNRSPP 477 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +3 Query: 195 PYVVPPQP---SPYGYTAQAPSP-PPTTG-----TACRTPPPASSGGTSLPTE 326 P+ PP P P+GY A AP P P G TPPP ++ + +P + Sbjct: 172 PFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQ 224 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS 314 PP P P + P+PPPT + +P S +S Sbjct: 199 PPTPRPPRLLSSQPAPPPTPPVSLPSPSMVVSSSSS 234 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/56 (30%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPP-----TTGTACRTPPPASSGGTS 314 P + S P PP P G + P PPP ++ PPPA G S Sbjct: 241 PPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAPVRGAS 296 >At1g52550.1 68414.m05932 expressed protein Length = 131 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSL 317 PS + P P P A AP PPT + PP ++ TSL Sbjct: 40 PSQTLFLVPTPKPVRRIAVAPLGPPTPPSPDPPPPKNTTELTSL 83 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 28.3 bits (60), Expect = 6.0 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +3 Query: 195 PYVVPPQP-SPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPTETGALPHTDTTPHDSR 371 P PP P SP T SPPP T A + PPP T+ P + P TP S Sbjct: 44 PATSPPSPPSPDTQT----SPPPAT--AAQ-PPPNQPPNTTPPPTPPSSPPPSITPPPSP 96 Query: 372 P*HPECP 392 P P+ P Sbjct: 97 P-QPQPP 102 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/76 (27%), Positives = 29/76 (38%), Gaps = 6/76 (7%) Frame = +3 Query: 162 PQLMLTAGPSMPY--VVPPQPSP----YGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 P L T G ++P+ PP P P + PPP + + PPP SG Sbjct: 203 PPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPPGLSGSQG--- 259 Query: 324 ETGALPHTDTTPHDSR 371 G P + D+R Sbjct: 260 -DGRFPESSDFTFDNR 274 >At5g56890.1 68418.m07099 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 1113 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = +3 Query: 195 PYVVPPQPSPY---GYTAQAPSPPPTTGTACRTPPPASSGGTSLP--TETGALPHTDT 353 P PP P P G+ QAPS P + + PP +S SLP + A P +D+ Sbjct: 30 PLSSPPSPLPETSKGF-GQAPSNSPESHKSDNVPPSKASSQPSLPPLADLAAPPPSDS 86 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 27.9 bits (59), Expect = 7.9 Identities = 25/89 (28%), Positives = 30/89 (33%) Frame = +3 Query: 108 PSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTP 287 PS E + P + P++ + P VP P P G PP T G P Sbjct: 79 PSRGPELAPLEVPELPNIPEISPSETPPEVTTVPSDPPPLG-------PPQTPGPEFPVP 131 Query: 288 PPASSGGTSLPTETGALPHTDTTPHDSRP 374 P S P P T TP D P Sbjct: 132 PSPSPPMPDTPN-----PPTPKTPPDVVP 155 >At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTA 275 PS VPP P+ + +P PPPT+ + Sbjct: 391 PSFKPSVPPHPTEGYHVRSSPVPPPTSSAS 420 >At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTA 275 PS VPP P+ + +P PPPT+ + Sbjct: 391 PSFKPSVPPHPTEGYHVRSSPVPPPTSSAS 420 >At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTA 275 PS VPP P+ + +P PPPT+ + Sbjct: 391 PSFKPSVPPHPTEGYHVRSSPVPPPTSSAS 420 >At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTA 275 PS VPP P+ + +P PPPT+ + Sbjct: 391 PSFKPSVPPHPTEGYHVRSSPVPPPTSSAS 420 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 Query: 186 PSMPYVVPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTS 314 P + V+ P P + Y P PPP + +PP S S Sbjct: 87 PPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSPPS 129 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/74 (28%), Positives = 26/74 (35%), Gaps = 7/74 (9%) Frame = +3 Query: 93 LKKQTPSEXRECGEIAXPTMIIEPQLMLTAGPSMPYVVPPQ----PSP---YGYTAQAPS 251 LKK P + E+ P + EP P +P PP P P Y + Sbjct: 178 LKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVEL 237 Query: 252 PPPTTGTACRTPPP 293 PPP C PP Sbjct: 238 PPPIPKKPCPPKPP 251 >At3g23130.1 68416.m02915 superman protein (SUP) / zinc finger (C2H2 type) family protein identical to superman protein GB:S60325 from [Arabidopsis thaliana]; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 204 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 207 PPQPSP-YGYTAQAPSPPP 260 PP P+P Y Y+ A SPPP Sbjct: 90 PPYPNPNYSYSTMANSPPP 108 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 159 EPQLMLTAGPSMPYV--VPPQPSPYGYTAQAPSPPPTTGTACRTPPPASSG--GTSLPTE 326 EP + T P P +PP PS + P PPP + + PPP +G +SL ++ Sbjct: 499 EPSNLHTDVPPPPGEEWIPPPPSE---SEDVPPPPPDSYSE-PIPPPPDNGHVASSLSSD 554 Query: 327 TGALPHT 347 + +P+T Sbjct: 555 SLGVPYT 561 >At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family protein Length = 660 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 7/80 (8%) Frame = +3 Query: 162 PQLMLTAGPSMPYVVPPQPSPYGYTAQAPSPPPTTGTA--CRTPPPA-----SSGGTSLP 320 P+ +TA M PP+PS TA +PP + C TP P+ ++ ++ Sbjct: 332 PRPSVTAAEPMNSTAPPRPS---VTAAEATPPNLSAPLPHCNTPQPSPISQQAAVESNTQ 388 Query: 321 TETGALPHTDTTPHDSRP*H 380 ++ ALP T ++RP H Sbjct: 389 MQSTALPRPSVTA-EARPLH 407 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 207 PPQPSPYGYTAQAPSPPPTTGTACRTPPP 293 PP P + PSPPP+ + R PPP Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPPRLPPP 58 >At2g25970.1 68415.m03117 KH domain-containing protein Length = 632 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = +3 Query: 123 ECGEIAXPTMIIEPQLMLTAGPSMPYVVPP---QPSPYGYTAQAPSPPPTTGTACRTPPP 293 + G A PT A + Y PP +P YG + Q+P P + G+ P Sbjct: 503 QAGYGAPPTSQAGYSSQPAAAYNSGYGAPPPASKPPTYGQSQQSPGAPGSYGSQSGYAQP 562 Query: 294 ASSG 305 A+SG Sbjct: 563 AASG 566 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 192 MPYVVPPQPSPYGYTAQAPSPPP-TTGTACRTPPPAS 299 +P V+PP P P SPP +GT CRT P A+ Sbjct: 718 LPPVIPPSPPP--------SPPTYVSGTKCRTTPLAT 746 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = +3 Query: 156 IEPQLMLTAGPSMPYVVPPQPSPYGYTAQAPSP--PPTTGTACRTPPPASSGGTSLPTET 329 I+P ++ + V PP SP + A SP P++ +PPP +S P Sbjct: 117 IDPNCDVSTPAASTPVSPPVESPTTSPSSAKSPAITPSSPAVSHSPPPVRH--SSPPVSH 174 Query: 330 GALPHTDTTPHDSR 371 + P + ++P SR Sbjct: 175 SSPPVSHSSPPTSR 188 >At1g17540.1 68414.m02157 protein kinase-related similar to serine/threonine protein kinase Fen [Lycopersicon esculentum] GI:1809259 Length = 733 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 183 GPSMPYVV--PPQPSPYGYTAQAPSPPPTTGTACRTPPPASSGGTSLPT 323 GP P PP PS + P P +T + PA +G S PT Sbjct: 171 GPQTPQAPQHPPHPSKHPSMMSDPGPTSSTSSESGRSSPALNGELSPPT 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,070,367 Number of Sequences: 28952 Number of extensions: 325659 Number of successful extensions: 3544 Number of sequences better than 10.0: 178 Number of HSP's better than 10.0 without gapping: 1501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2583 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -