BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0258 (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-17|AAU87811.1| 178|Caenorhabditis elegans C-type lecti... 31 0.65 AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical... 28 6.1 >AC024817-17|AAU87811.1| 178|Caenorhabditis elegans C-type lectin protein 80 protein. Length = 178 Score = 31.5 bits (68), Expect = 0.65 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 595 RGGCVYQYHYLPFPLQCIGHFPLHFMSSYGLTYFGYNLGTWWFSL 729 R C YQ + + F++SY +T FG N G++W L Sbjct: 46 RSWCRYQNSVVSYLATVSDQITASFLASYAVTAFGSNEGSFWIGL 90 >AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical protein Y102A5C.25 protein. Length = 318 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 452 KYINLGCAEIPTFIAL*ILQYFITKHTLDTITSLY 556 KYI L + TF ++ +L Y +T HT ++TSL+ Sbjct: 223 KYIFLQTMVVFTFKSIQVLVYLMTNHTGISLTSLF 257 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,967,161 Number of Sequences: 27780 Number of extensions: 398298 Number of successful extensions: 751 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -