BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0255 (267 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizo... 27 0.44 SPCC1223.09 |||uricase |Schizosaccharomyces pombe|chr 3|||Manual 25 1.8 SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizos... 25 1.8 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 24 4.1 SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc... 24 4.1 SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pom... 23 7.2 SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces ... 23 9.6 >SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 27.1 bits (57), Expect = 0.44 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 129 KQFYQLKNNFG*FFYRPS-FVINLVXSFILG 218 K + K NF F+Y + FV+ L+ SFILG Sbjct: 28 KLLFTGKLNFADFYYNTNPFVVGLLLSFILG 58 >SPCC1223.09 |||uricase |Schizosaccharomyces pombe|chr 3|||Manual Length = 296 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 147 LTDKIASIQASMSFLFKCFNTFYTICPFFLN 55 +TD+I S ++ FK F+TF + F N Sbjct: 177 VTDRIFSTSIDCNYTFKHFDTFEELAGFDFN 207 >SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 268 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 83 NVLKHLNKKDIDAWIEAILSVKK*FWLIFLSSI 181 ++L+ LN KDI ++ ILSV + LSS+ Sbjct: 9 DLLRRLNPKDISKNLDTILSVAPDLADVLLSSV 41 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 23.8 bits (49), Expect = 4.1 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -1 Query: 159 QNYFLTDKIASIQASMSFLFKCFNT 85 +++F K + +++ FL+KC N+ Sbjct: 503 KSFFYISKESGTDSALKFLYKCLNS 527 >SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1284 Score = 23.8 bits (49), Expect = 4.1 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 183 MMDDKKINQNYFLTDKIASIQASMSFLFKCFNTFYTICPFFLN*YIEILNF 31 +MD + NYFL A S+SF + + Y + Y E+LNF Sbjct: 407 VMDQENSLTNYFLLQNTAIQYLSISFFMRQQSKAYKKL-LLRSLYAELLNF 456 >SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pombe|chr 2|||Manual Length = 1067 Score = 23.0 bits (47), Expect = 7.2 Identities = 6/18 (33%), Positives = 14/18 (77%) Frame = -1 Query: 123 QASMSFLFKCFNTFYTIC 70 ++++S L++C T+Y +C Sbjct: 698 KSALSSLWRCATTYYKVC 715 >SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 965 Score = 22.6 bits (46), Expect = 9.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 174 DKKINQNYFLTDKIASIQASMSFLFKCFNTFYTICPFFLN-*YIEILNF 31 DK NY + ++ QAS + N+ CP+ N I +LNF Sbjct: 336 DKSYKSNYLFSVVLSPHQASWNIYNSFDNSMVLWCPYGKNKTLICLLNF 384 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,458 Number of Sequences: 5004 Number of extensions: 13193 Number of successful extensions: 34 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 61 effective length of database: 2,057,234 effective search space used: 55545318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -