BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0253 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_4711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) 28 9.5 >SB_23751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 614 RFDQTSVNLILRITRQLIESKSILRFTI 697 RFDQT++ + + RQ ++KSI RF + Sbjct: 13 RFDQTNLRPMAEVIRQRYDTKSITRFML 40 >SB_4711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 7/63 (11%) Frame = -2 Query: 634 YACLVESTLNSISILGITKTNLFTYSKLANNICYVHYCH-------ETVYYVHNQYYAYV 476 +A + T+N+ + IT T T + + NN+ H+ H T+ + HNQ+YAY Sbjct: 11 HAVSITITINNTITVTITITITVTIT-INNNLQQYHFQHLFNTTIINTLQHYHNQHYAYT 69 Query: 475 CFN 467 N Sbjct: 70 PHN 72 >SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1705 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = -2 Query: 631 ACLVESTLNSISILGITKTNLFTYSKLANNICYVHYCHETVYYVHNQYYAYVC 473 A LV SI+IL KT TY L NI V+ C + ++ +YA+ C Sbjct: 1045 ASLVSIMNYSITILSTNKT--ITYFDLVVNILDVNECSPSTLSSNHGHYAHNC 1095 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,466,345 Number of Sequences: 59808 Number of extensions: 421946 Number of successful extensions: 962 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -