BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0251 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.78 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 4.2 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.0 bits (52), Expect = 0.78 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 134 LPVAVPPRXLRNAGLTVQDVSDIT---RAPEMLGGRVKTLH 247 +P PP +N + D S + AP MLGGR T + Sbjct: 312 MPCTQPPSAPQNLTVNFVDQSTVFLSWNAPHMLGGRTDTTY 352 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 241 FTSSGHAGILARLSDSDQEDMKRQKYEMISVVVCNLYP 354 F + G G+L L+++D KY++I+ N P Sbjct: 7 FLAVGLFGVLLLLTNADNSVHILSKYQLITSTTLNWLP 44 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 122 PHSDRLFANESRPVLSETLRRASFPFDAMFCLLK 21 P+ D L+ + S T+ FPFD C++K Sbjct: 135 PNGDVLWVPPAIYQSSCTIDVTYFPFDQQTCIMK 168 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,885 Number of Sequences: 438 Number of extensions: 3213 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -