BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0251 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protei... 64 7e-11 At3g48950.1 68416.m05347 glycoside hydrolase family 28 protein /... 29 2.6 >At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protein similar to SP|P12048 Bifunctional purine biosynthesis protein purH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] {Bacillus subtilis}; contains Pfam profiles PF01808: AICARFT/IMPCHase bienzyme, PF02142: MGS-like domain Length = 596 Score = 64.5 bits (150), Expect = 7e-11 Identities = 47/142 (33%), Positives = 69/142 (48%), Gaps = 5/142 (3%) Frame = +1 Query: 31 QNMASNG-KLALLSVSDKTGLLSLAKSLSECGLQLIASXGTATXASERXPHSSRC--VGH 201 Q+ S+G K AL+S+SDK L SL L E G ++++ GTA+ ++ + H Sbjct: 64 QSSGSSGEKQALISLSDKRDLASLGNGLQELGYTIVSTGGTASTLENAGVSVTKVEKLTH 123 Query: 202 HESTGDARRSGENFTSSGHAGILARLS-DSDQEDMKRQKYEMISVVVCNLYPFVXSV-SX 375 D R + + H GILAR + E + VVV NLYPF V + Sbjct: 124 FPEMLDGR--VKTLHPNIHGGILARRDVEHHMEALNEHGIGTFDVVVVNLYPFYEKVTAP 181 Query: 376 XXVTVADAVENIDIGXVTLLRA 441 ++ D +ENIDIG ++RA Sbjct: 182 GGISFEDGIENIDIGGPAMIRA 203 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +2 Query: 161 LRNAGLTVQDVSDITRAPEMLGGRVKTLHP 250 L NAG++V V +T PEML GRVKTLHP Sbjct: 108 LENAGVSVTKVEKLTHFPEMLDGRVKTLHP 137 >At3g48950.1 68416.m05347 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein weak similarity to SP|P27644 Polygalacturonase (EC 3.2.1.15) (Pectinase) {Agrobacterium tumefaciens}; contains PF00295: Glycosyl hydrolases family 28 Length = 469 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 54 TSSSQRFRQDGSTLVSKEPVGMWPAVDCQXRYRHGRFGTXASQF 185 TS F Q G+T+++ + WP + Y GR GT +F Sbjct: 97 TSHFTLFIQRGATILASQDESEWPVIAPLPSYGKGRDGTGTGRF 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,479,473 Number of Sequences: 28952 Number of extensions: 258925 Number of successful extensions: 670 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -