BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0250 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 32 0.100 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 30 0.40 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 2.8 SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosacchar... 27 3.8 SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch... 26 5.0 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 26 5.0 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 26 5.0 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 25 8.7 SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces p... 25 8.7 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 31.9 bits (69), Expect = 0.100 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +1 Query: 307 IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEV 486 + SE+T + T E +E+ RE I LRS L D + VE + E + E+ Sbjct: 974 LASEKTLEMMNETHEQFKHLVESEISTREEKITSLRSELLDLNKRVEVLKEEKESSSKEL 1033 Query: 487 YKAIED 504 K +ED Sbjct: 1034 AKQLED 1039 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 29.9 bits (64), Expect = 0.40 Identities = 12/57 (21%), Positives = 31/57 (54%) Frame = +1 Query: 322 TNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYK 492 T N I++ + + + HEE + ELR++++++++ E+ ++ E+Y+ Sbjct: 85 TLNNILSMRTETGSMAKAHEEVSQQINTELRNKIREYIDQTEQQKVVAANAIEELYQ 141 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 27.1 bits (57), Expect = 2.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 8 DAIQLFRSLCRLKVEAMEVETKSTEIRCQEMSKGGLAYE 124 D L+ L R + +E E ++ +C E K L YE Sbjct: 2536 DEHDLYHGLWRRRANFLETEVATSHEQCHEWEKAQLVYE 2574 >SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 289 Score = 26.6 bits (56), Expect = 3.8 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 340 ATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ--QTAEVYKAIEDKRP 513 A +E + ++E +EA +NE R L+ LEG ++ L++ Q + YK E + Sbjct: 5 AVRERRQFIYKRNQELQEAKLNEKRRALRKALEGNKELNKDLQEDSQLQKDYKYDESRAT 64 Query: 514 Q 516 Q Sbjct: 65 Q 65 >SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1822 Score = 26.2 bits (55), Expect = 5.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 8 DAIQLFRSLCRLKVEAMEVETKSTEIRCQEM 100 DA +FRS+CRL V + K + IR Q M Sbjct: 388 DAFLVFRSMCRLAVRQTSPD-KVSNIRSQAM 417 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 316 EQTNNFIVATKEA-LDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAE 483 +Q VA ++A +E K E + + + SR+K + +E TRL + Q E Sbjct: 460 KQVEELTVALNSGKMNAIVEAESSKNELWDSMMVSRMKTQEQSIELTRLYKQLQDIE 516 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 349 EALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ 471 E L K+++ ++++ INEL R+K + V + T+++ Sbjct: 530 EGLTLKIDSITKEKDRLINELEQRIKSYEVNVSELNGTIDE 570 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.4 bits (53), Expect = 8.7 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 53 AMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPS 193 A+ ETKST ++ GG A +A P +P P +P P+ Sbjct: 867 AITPETKST---VNQIMSGGEALAAPVAVPAPIPAPVAEPAPPAAPA 910 >SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = +1 Query: 313 SEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYK 492 SEQT A + + K E E L++ KD+ ++K LE++ + K Sbjct: 391 SEQTQLVEEALTKVMKEKYREKENNLELLETNLKTHHKDYKHALKKRITALEEEKNRLIK 450 Query: 493 AI 498 I Sbjct: 451 EI 452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,356,088 Number of Sequences: 5004 Number of extensions: 39137 Number of successful extensions: 162 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -