BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0250 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 29 0.15 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 25 3.3 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 4.3 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 7.6 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 29.1 bits (62), Expect = 0.15 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +3 Query: 273 SEDGQDRGGVPHPQRADE*--LHRRHQGGSRRQDGDPRGKTRGLHQR 407 ++ G + GV PQ++ + HR+HQ +Q+G + + G+HQ+ Sbjct: 248 NQRGNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNGQQQQQRMGIHQQ 294 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +1 Query: 301 SRIRSEQTNNFIVATKEAL-DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 477 S+ R + + + +E L DAK++ HE+ R E+ K + GV + + Q T Sbjct: 476 SKERIHELQSELDNVREQLGDAKIDKHEDARRKKKQEVVELFKLEVPGVYDRMINMCQPT 535 Query: 478 AEVYKAIEDK 507 + Y K Sbjct: 536 HKRYNVAVTK 545 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 384 KTRGLHQRAA-LPSQGSS*GR*EDQVDPGTADRGSVQ 491 +TR + +R LP +G+ G PGT DR S+Q Sbjct: 2 ETRSMRKRTTRLPEEGAPTG-----AGPGTGDRASIQ 33 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/29 (31%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +2 Query: 464 WNSRP---RKCTRPSKIRDHSXRQARREP 541 W P R CT+P + D+ R+ + +P Sbjct: 394 WTPAPFLDRTCTKPYMLEDYDGRRVQLQP 422 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,080 Number of Sequences: 2352 Number of extensions: 10903 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -