BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0248 (736 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58727-2|AAB00582.2| 462|Caenorhabditis elegans Hypothetical pr... 29 3.4 U41548-2|AAA83204.1| 399|Caenorhabditis elegans Hypothetical pr... 29 3.4 >U58727-2|AAB00582.2| 462|Caenorhabditis elegans Hypothetical protein D1005.2 protein. Length = 462 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -2 Query: 717 KLYQILVN*NINFRMSQKSKINVDIKWGLLLQQDQKMMYL 598 ++ Q++++ N+++ M K VD+K G L+ +MM+L Sbjct: 228 QIVQLMLDKNVDYIMECTPKTQVDVKGGTLIDIGGRMMHL 267 >U41548-2|AAA83204.1| 399|Caenorhabditis elegans Hypothetical protein M02F4.1 protein. Length = 399 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = -1 Query: 682 LQDVPKIQNKCGYKMGSPPPAGSKNDVFKFRSVNNIVIAPAKTGSDNNNKNAVXPTAHQI 503 L+ V ++ G + GSP +KND F+ + N ++ G N +N TAH I Sbjct: 332 LKQVGVVEVYPGIQQGSPHVLCAKNDDHCFKKIQNTILVTEAIGKIFNREN----TAHSI 387 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,398,510 Number of Sequences: 27780 Number of extensions: 243343 Number of successful extensions: 575 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -