BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0248 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11840.1 68418.m01384 expressed protein predicted proteins in... 29 4.2 >At5g11840.1 68418.m01384 expressed protein predicted proteins in Synechococcus ,Cyanophora and other organisms Length = 255 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 591 RNLNTSFFDPAGGGDPILYPHLFWIFGTS*SLYFNLP--GFGIISPNYFP 734 ++L+TSF GD I Y ++ G S + + LP FG I P Y P Sbjct: 74 QSLSTSFPFSWASGDLIEYSTRLFLTGASFAFFVGLPVSWFGSIGPEYEP 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,511,795 Number of Sequences: 28952 Number of extensions: 220396 Number of successful extensions: 440 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -