BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0245 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 29 5.4 SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) 29 5.4 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 105 KRKKCYQLTCIQGSETHQEHQQ**RRCNQHLC 10 +R CYQ T GS Q RCN+ LC Sbjct: 1009 RRPSCYQYTASTGSFAQVSDQDYLVRCNEQLC 1040 >SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) Length = 835 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 101 EKNAIN*PAFRVPKLTKNTNNNRDGATNIFA 9 E NA P+F VP+ TN+ ++G N+ A Sbjct: 726 EGNAQQSPSFSVPQAPAKTNDKKEGGLNVVA 756 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,176,189 Number of Sequences: 59808 Number of extensions: 311767 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -