BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0239 (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 25 0.66 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 2.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 6.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.2 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 25.0 bits (52), Expect = 0.66 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 216 EKVRLDTLDTETGSRRTPDAIHERLPRGTHGDSV 317 +++RL D + R DAIH + RG +G ++ Sbjct: 299 DQIRLSLDDMDRWRDRIYDAIHSGVVRGDNGQNI 332 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -2 Query: 93 PANGEGSLIACITYGSYSFACTEP 22 P G G L C+ +S C EP Sbjct: 341 PQEGLGELAVCVNERPWSLYCGEP 364 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/54 (22%), Positives = 22/54 (40%) Frame = +3 Query: 165 PIKKPNSNQTISSKDLAEKVRLDTLDTETGSRRTPDAIHERLPRGTHGDSVYRY 326 P+K S +D++ V L + G R+T +++ + G V Y Sbjct: 39 PLKTTQSVSVTKDQDVSSSVNRFRLRSRPGHRKTDNSLSATSKKDKDGYKVVCY 92 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 454 RGWIDLERARWAPGCLELARREQRXKMQHY 543 R W L R A ELARRE++ MQ Y Sbjct: 515 RRWHALGREEQAK-YYELARRERQLHMQLY 543 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 454 RGWIDLERARWAPGCLELARREQRXKMQHY 543 R W L R A ELARRE++ MQ Y Sbjct: 407 RRWHALGREEQAK-YYELARRERQLHMQLY 435 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,369 Number of Sequences: 336 Number of extensions: 3504 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -