BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0239 (766 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0928 + 12464325-12464498,12466494-12466679,12466929-124670... 29 4.1 03_02_0339 - 7623897-7625837 29 4.1 10_01_0164 + 1863890-1866253 29 5.4 11_04_0281 + 15733505-15733647,15734366-15734443,15734835-157350... 28 9.4 06_03_0575 + 22431744-22432212,22432473-22433077 28 9.4 01_01_0591 - 4401847-4402063,4402860-4403002,4403339-4403447,440... 28 9.4 >03_02_0928 + 12464325-12464498,12466494-12466679,12466929-12467021, 12467212-12467394,12467506-12467608,12467695-12467865, 12468086-12469084,12469178-12469254,12469485-12470337, 12470878-12471000,12471526-12471878 Length = 1104 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 564 VXSRSDHVMLHLXSLLSPRQLKTARRPSSPFQIDPTSPSYTNTVHDESGYDVS 406 + S SD V L LLSP +T R SP ++ + HDES +D S Sbjct: 590 ITSNSDVV---LPGLLSPSSTETDERRLSPVSSSHSTEDSSQQSHDESNWDNS 639 >03_02_0339 - 7623897-7625837 Length = 646 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 145 ENEPWLWLLVDRVKRQHAGQRRRITHSVHNLRLL 44 +NEP L+L+ D + R H G + HNL L Sbjct: 145 QNEPILFLIWDHIARLHTGNLAARADAAHNLASL 178 >10_01_0164 + 1863890-1866253 Length = 787 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 451 WRGWIDLERARWAPGCLELARRE 519 W W + R W+PGC L+ RE Sbjct: 403 WMSWNYVRRILWSPGCSLLSARE 425 >11_04_0281 + 15733505-15733647,15734366-15734443,15734835-15735077, 15735868-15736012,15736234-15736293,15736376-15736471, 15736651-15737067,15737824-15737964,15738043-15738213, 15738394-15738651,15738741-15738889,15739060-15739557, 15740147-15740420,15740631-15740696,15740891-15741057, 15741413-15741497,15741673-15741732 Length = 1016 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 466 DLERARWAPGCLELARREQRXKMQHYVIRSRGYNQ 570 +L R WAPG ++ R + K+ + + GYNQ Sbjct: 403 ELLRKLWAPGRTPVSPRPFKTKLSRFAPQFSGYNQ 437 >06_03_0575 + 22431744-22432212,22432473-22433077 Length = 357 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = -1 Query: 421 GIRCELXHXPFESRSHGCCRVSDRRQAEGLCRYR*TLSPCVPRGNRS*IASGVLREPVSV 242 GI E + P+E R+ G CR S + A + ++ VP N + + V +PVSV Sbjct: 216 GIAAESDY-PYEDRALGTCRASGKPVAASIRGFQ-----YVPPNNETALLLAVAHQPVSV 269 Query: 241 S 239 + Sbjct: 270 A 270 >01_01_0591 - 4401847-4402063,4402860-4403002,4403339-4403447, 4403546-4404707,4405754-4405865,4405980-4406015 Length = 592 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 306 GDSVYRYRHKPSACLRSLTLQQPWLRLSKGKWXSSHRIP 422 G + YR R + S LR+ + L+L G W ++ ++P Sbjct: 55 GGAPYRLRRRNSETLRAQYINTKELKLCVGTWNAAGKVP 93 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,838,765 Number of Sequences: 37544 Number of extensions: 434723 Number of successful extensions: 1191 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -