BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0237 (472 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.10c |agl1|agl|alpha-glucosidase Agl1|Schizosaccharomyc... 26 3.3 SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting... 25 4.4 SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual 25 7.7 >SPAPB24D3.10c |agl1|agl|alpha-glucosidase Agl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 25.8 bits (54), Expect = 3.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 14 GFTNLKPFTNYNITFYIWDSRLNKTYA 94 GFT FTN ++ Y D +N TYA Sbjct: 440 GFTAFPDFTNPDVVDYWKDCLINLTYA 466 >SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting complex subunit Apc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 25.4 bits (53), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 128 GIPSPPLRVTVRQNIGSRVEVLWDRPEV 211 GIPS L+ + + +G RV W+R V Sbjct: 323 GIPSDLLKEWINERVGDRVLKNWERAMV 350 >SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual Length = 1489 Score = 24.6 bits (51), Expect = 7.7 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 142 RRRYSFACSRVHVFT*RICLIQ-SAVPYVKRYIIV 41 RR+Y R+ +FT LIQ SA+ ++ R+ IV Sbjct: 435 RRKYHSLIERLDLFTPSFVLIQSSALGFLTRHAIV 469 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,389,457 Number of Sequences: 5004 Number of extensions: 23530 Number of successful extensions: 57 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -