BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0227 (776 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 4.6 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 8.0 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 449 AWRILLRNDRKSRHRXIKKQVAMNAXAATSQ 541 AWR L+ R S R K+ AAT Q Sbjct: 2 AWRTLMLRSRGSTERLCAKRYENTVAAATKQ 32 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 329 NRSFGHLVHALGRAAGGAKLPSAGLA 252 NR G + H G GG AGLA Sbjct: 238 NRGLGKMHHKAGGGGGGGAGGGAGLA 263 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,522 Number of Sequences: 2352 Number of extensions: 14660 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -