BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0227 (776 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 45 3e-04 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 31 3.5 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 31 3.5 EF623992-1|ABR25252.1| 354|Homo sapiens Uba6-specific E2 conjug... 31 6.1 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 45.2 bits (102), Expect = 3e-04 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = +3 Query: 471 MIGRADIEXXXXXXXXXXXXPQASYPCGNFSGHLLLKTLYTKGS 602 MIGRADIE PQASYPCGNFS LK ++GS Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLKPKRSEGS 44 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 31.5 bits (68), Expect = 3.5 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -1 Query: 305 HALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSPESRE 174 H A G P++ TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSNC--TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 31.5 bits (68), Expect = 3.5 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -1 Query: 305 HALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSPESRE 174 H A G P++ TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSNC--TPTPPTPVLPGPASLCSPASPELRQ 92 >EF623992-1|ABR25252.1| 354|Homo sapiens Uba6-specific E2 conjugating enzyme 1 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.1 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = -1 Query: 308 VHALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSP 186 V A AAGGA P +GLA P P A + A + S W P Sbjct: 45 VWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDP 85 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,452,682 Number of Sequences: 237096 Number of extensions: 2275434 Number of successful extensions: 7601 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7601 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9423020542 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -