BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0227 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 30 2.0 At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 29 4.5 At2g18250.1 68415.m02128 cytidylyltransferase domain-containing ... 28 7.9 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 288 GRWCEATIRGISLNASKAEASLAESGKDMLTVEPRESGGSKQCD 157 G W + + S +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 541 LACGSXSVHSDLLFDXSMSALPIIAKQNSPSVGLFT 434 + C S SV LL + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At2g18250.1 68415.m02128 cytidylyltransferase domain-containing protein similar to CoA synthase [Mus musculus] GI:21780289, bifunctional phosphopantetheine adenylyl transferase / dephospho CoA kinase [Sus scrofa] GI:20465246; contains Pfam profile PF01467: Cytidylyltransferase Length = 176 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/58 (22%), Positives = 31/58 (53%) Frame = -3 Query: 261 GISLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 88 G+S+N +AE L++ +++ + S G+K T R +++ ++++ P + S Sbjct: 119 GLSVNRKRAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPAEEKAS 176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,170,697 Number of Sequences: 28952 Number of extensions: 313988 Number of successful extensions: 698 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -