BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0225 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0293 + 2207782-2208148,2208515-2208567,2208622-2208698,220... 29 5.4 01_05_0612 - 23652121-23652400,23653031-23654427 28 9.4 >11_01_0293 + 2207782-2208148,2208515-2208567,2208622-2208698, 2209377-2209772,2209953-2210111,2210522-2210933 Length = 487 Score = 28.7 bits (61), Expect = 5.4 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 400 SMIEYSRSKHVSAVN---GQRKHHLLNCFSCIYIPTIFRIFEICNMFIFKHTHIVLLKYG 570 +M+E R+K V V G+ + L C + +P IFE+ I KH ++ K+ Sbjct: 171 NMLEKLRNKRVVFVGDSIGRNQWESLLCMLSVAVPDKSSIFEVNGNPITKHMGFLIFKFR 230 Query: 571 AVSC 582 +C Sbjct: 231 DYNC 234 >01_05_0612 - 23652121-23652400,23653031-23654427 Length = 558 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 133 TNYTERRKAIPENEDRCWWQT 71 TN+ A E++D CWW+T Sbjct: 226 TNWLRIHHAAGEDQDLCWWET 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,652,954 Number of Sequences: 37544 Number of extensions: 324131 Number of successful extensions: 563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -