BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0225 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 25 2.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.9 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 690 NYGKPINEITTLGYIWSLC*VKYQNLIVNKIAQIFVTAHSAVL 562 NY +P N L Y W+L K Q + + I Q+ ++ S +L Sbjct: 176 NYFQPANVEELLKYAWALPMHKKQRSMYDLIGQLVQSSKSPML 218 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 551 LFS*STAL*AVTNICAILFTIKF 619 LF+ + +L A+ NIC +LF + F Sbjct: 1742 LFALAMSLPALFNICLLLFLVMF 1764 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,348 Number of Sequences: 2352 Number of extensions: 15517 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -