BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0224 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 30 0.37 SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 26 4.6 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 29.9 bits (64), Expect = 0.37 Identities = 22/55 (40%), Positives = 27/55 (49%) Frame = +3 Query: 81 MPTEPQSPTPNSKTIFTTASSLPITTMPLKKXNRSTRTRRAKSSQMS*TNSYXTT 245 +PT S TP S TTA+S T PL N +T T A S+ +S NS T Sbjct: 415 LPTSSVSSTPLSSANSTTATSASST--PLSSVNSTTAT-SASSTPLSSVNSTTAT 466 Score = 25.4 bits (53), Expect = 8.0 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 81 MPTEPQSPTPNSKTIFTTASSLPITTMPLKKXNRSTRT 194 +PT S TP S TTA+S T PL N +T T Sbjct: 529 LPTSSVSSTPLSSANSTTATSASST--PLTSVNSTTAT 564 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 78 YMPTEPQSPTPNSKTIFTTASSLPITTMP 164 YMP P +P PN+ IF + P+T +P Sbjct: 418 YMPITP-TPYPNNAKIFGYPNQPPLTPIP 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,238,498 Number of Sequences: 5004 Number of extensions: 33903 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -