BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0224 (704 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S75768-1|AAD14188.1| 595|Homo sapiens CD30 antigen protein. 31 4.0 M83554-1|AAA51947.1| 595|Homo sapiens CD30 antigen protein. 31 4.0 AY498860-1|AAR32099.1| 595|Homo sapiens tumor necrosis factor r... 31 4.0 AL357835-1|CAH73719.1| 595|Homo sapiens tumor necrosis factor r... 31 4.0 AJ289159-1|CAC16652.1| 595|Homo sapiens cytokine receptor CD30 ... 31 4.0 >S75768-1|AAD14188.1| 595|Homo sapiens CD30 antigen protein. Length = 595 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 469 PXDFWTRLVLAIAVGKSAIVVAXHRATSKQXR 374 P FW LVL + VG SA ++ RA K+ R Sbjct: 386 PVLFWVILVLVVVVGSSAFLLCHRRACRKRIR 417 >M83554-1|AAA51947.1| 595|Homo sapiens CD30 antigen protein. Length = 595 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 469 PXDFWTRLVLAIAVGKSAIVVAXHRATSKQXR 374 P FW LVL + VG SA ++ RA K+ R Sbjct: 386 PVLFWVILVLVVVVGSSAFLLCHRRACRKRIR 417 >AY498860-1|AAR32099.1| 595|Homo sapiens tumor necrosis factor receptor superfamily, member 8 protein. Length = 595 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 469 PXDFWTRLVLAIAVGKSAIVVAXHRATSKQXR 374 P FW LVL + VG SA ++ RA K+ R Sbjct: 386 PVLFWVILVLVVVVGSSAFLLCHRRACRKRIR 417 >AL357835-1|CAH73719.1| 595|Homo sapiens tumor necrosis factor receptor superfamily, member 8 protein. Length = 595 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 469 PXDFWTRLVLAIAVGKSAIVVAXHRATSKQXR 374 P FW LVL + VG SA ++ RA K+ R Sbjct: 386 PVLFWVILVLVVVVGSSAFLLCHRRACRKRIR 417 >AJ289159-1|CAC16652.1| 595|Homo sapiens cytokine receptor CD30 protein. Length = 595 Score = 31.1 bits (67), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 469 PXDFWTRLVLAIAVGKSAIVVAXHRATSKQXR 374 P FW LVL + VG SA ++ RA K+ R Sbjct: 386 PVLFWVILVLVVVVGSSAFLLCHRRACRKRIR 417 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,120,257 Number of Sequences: 237096 Number of extensions: 1243018 Number of successful extensions: 2989 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2989 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -