BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0223 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.0 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 23 2.6 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 23 2.6 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 4.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 96 KPPAVMVPIPQYPLFSGTLSELGVRQVDYYLDEEHDWALQILELERS 236 +PP + IP Y L S T +G+ + Y + IL E S Sbjct: 136 QPPPAHMGIPPYQLDSKTAGSMGLTRPPMYPFPAGQYPYPILSPEMS 182 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 96 KPPAVMVPIPQYPLFSGTLSELGVRQVDYYLDEEHDWALQILELERS 236 +PP + IP Y L S T +G+ + Y + IL E S Sbjct: 28 QPPPAHMGIPPYQLDSKTAGSMGLTRPPMYPFPAGQYPYPILSPEMS 74 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 213 QILELERSWREGQYDSNVRALVV 281 Q++ELER + G+Y S R + + Sbjct: 99 QLVELEREFHHGKYLSRPRRIQI 121 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 213 QILELERSWREGQYDSNVRALVV 281 Q++ELER + G+Y S R + + Sbjct: 90 QLVELEREFHHGKYLSRPRRIQI 112 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Frame = +3 Query: 15 PDDIYLGSGA------SDVIKSVLTLFVEDVGGKPPAVMVPIPQ 128 P++I LG+G + + + L + G P ++VPIPQ Sbjct: 161 PNNIILGNGTGVQLVPTRLANGDIALVLPTQGASPLPLLVPIPQ 204 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,881 Number of Sequences: 336 Number of extensions: 3711 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -