SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0219
         (555 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    22   4.1  
AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    22   4.1  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    21   7.2  
AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    21   9.5  

>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +1

Query: 388 IYVIGLIYLKHKTSMSLNRSRYIRGL 465
           I  + + Y +HK      R RY +GL
Sbjct: 394 IATVTVNYYRHKQKRRDERERYFKGL 419


>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 272 ICELIDKFNKL 304
           ICEL+D FN +
Sbjct: 229 ICELVDAFNNI 239


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 14/52 (26%), Positives = 24/52 (46%)
 Frame = -2

Query: 164 ETYEQNVLTVRYLNI*S*TFLNV*IDYTQSKVIIIVLDVYKI*KTFIFYLNI 9
           E  EQ  + +RY  I S T+  + +      ++ + L +YK+  T   Y  I
Sbjct: 230 ECIEQYNVILRYTKIVSDTYQGILVVQFFCSLVALCLTMYKLSLTEDLYFAI 281


>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = +2

Query: 272 ICELIDKFNK 301
           IC LID+FN+
Sbjct: 219 ICNLIDEFNE 228


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,123
Number of Sequences: 336
Number of extensions: 1909
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13725787
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -