BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0218 (552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 3.1 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.5 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +3 Query: 105 NLQSLKVCLTFHFRHARRGIDAISLAPVETAP 200 +L ++++C RRG + L PV + P Sbjct: 200 DLNAVRLCFQVFLEGERRGKFTVPLTPVVSEP 231 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 47 VYNFSNGTLSVCVLNDRHTQF 109 + +FS CVL+D TQF Sbjct: 248 IEDFSGYIKPKCVLSDHGTQF 268 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = -1 Query: 183 APEISHRSLDEHVESEKSNTPSNFVNCVWRSFKTQTLNVPFE 58 +PE+ S D E N + + + +T T PFE Sbjct: 123 SPEVKDSSRDRPFTCEVCNRSFGYKHVLQNHERTHTGEKPFE 164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,082 Number of Sequences: 336 Number of extensions: 2485 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -