BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0218 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61370.1 68418.m07700 pentatricopeptide (PPR) repeat-containi... 33 0.096 At5g20050.1 68418.m02387 protein kinase family protein contains ... 32 0.22 At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00... 29 1.6 At1g51920.1 68414.m05853 expressed protein 29 2.1 At5g35735.1 68418.m04276 auxin-responsive family protein similar... 29 2.7 At4g19690.2 68417.m02892 iron-responsive transporter (IRT1) iden... 29 2.7 At3g07390.1 68416.m00881 auxin-responsive protein / auxin-induce... 27 6.3 At5g60280.1 68418.m07555 lectin protein kinase family protein co... 27 8.3 At3g18550.1 68416.m02359 TCP family transcription factor, putati... 27 8.3 >At5g61370.1 68418.m07700 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 487 Score = 33.5 bits (73), Expect = 0.096 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 2/97 (2%) Frame = -1 Query: 294 NRNPLLASALTIRRTCFLCSLFYID--DHSLMTEARFLRAPEISHRSLDEHVESEKSNTP 121 NR L S T + T + CS +D + +L R + +P L+E++ + Sbjct: 9 NRFTYLTS--TAKLTRYFCSHHLVDRSETALHEVIRIVSSPVGGLDDLEENLNQVSVSPS 66 Query: 120 SNFVNCVWRSFKTQTLNVPFEKLYTKWSCERIESTLH 10 SN V V S K +T + ++ WSC+ + S+LH Sbjct: 67 SNLVTQVIESCKNETSPRRLLRFFS-WSCKSLGSSLH 102 >At5g20050.1 68418.m02387 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 452 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = -3 Query: 277 RIGVDDPPDMFPVFTFLHRRSLAHDGGAVSTGARDIASIPRRACRK*KVKHTFKLCKLCM 98 R+ V++PPD V L LA D STG R + +IP+ + + F+L +C Sbjct: 391 RVPVNEPPDSDVVVVDL----LAADDDDASTGVRRVVNIPKLQIHR---ERNFRLSSICS 443 Query: 97 AIV 89 +I+ Sbjct: 444 SII 446 >At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 426 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 108 NCVWRSFKTQTLNVPFEK 55 NCVWR F T L P+EK Sbjct: 69 NCVWRFFSTPQLENPYEK 86 >At1g51920.1 68414.m05853 expressed protein Length = 78 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 286 IPVRNSNAVMSSPFGFLISHRPMSKSCXYRERRPSGSCGKC 408 +P+ SNA P + S RP+ +C E P GSC +C Sbjct: 23 LPLSQSNATRI-PRAPISSRRPICPACVCCEPAPLGSCCRC 62 >At5g35735.1 68418.m04276 auxin-responsive family protein similar to auxin-induced protein AIR12 GI:11357190 [Arabidopsis thaliana] Length = 404 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +2 Query: 8 ECSVLSIL-SQLHFVYNFSNGTLSV 79 +CS LS L S LH+ YN NGT+S+ Sbjct: 42 DCSDLSALGSFLHWTYNEQNGTVSI 66 >At4g19690.2 68417.m02892 iron-responsive transporter (IRT1) identical to Fe(II) transport protein [Arabidopsis thaliana] gi|1353266|gb|AAB01678; member of the Zinc (Zn2+)-Iron (Fe2+) permease (ZIP) family, PMID:11500563 Length = 339 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 11 CSVLSILSQLHFVYNFSNGTLSVCVLNDRHTQFTKFEGVFDFSLST 148 C++ +++ L F F L C+L +T KF F F+++T Sbjct: 212 CTIKGLIAALCFHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTT 257 >At3g07390.1 68416.m00881 auxin-responsive protein / auxin-induced protein (AIR12) identical (with 7 residue gap) to auxin-induced protein AIR12 GI:11357190 [Arabidopsis thaliana] Length = 273 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 5 NECSVLSIL-SQLHFVYNFSNGTLSV 79 + C L +L S LH+ YN SN +LSV Sbjct: 62 DSCEDLPVLNSYLHYTYNSSNSSLSV 87 >At5g60280.1 68418.m07555 lectin protein kinase family protein contains Pfam domains, PF00138: Legume lectins alpha domain, PF00139: Legume lectins beta domain, and PF00069: Protein kinase domain Length = 657 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 159 GIDAISLAPVETAPPS*ASDRRCKKVNTGNMSGGS 263 GID SL VE+AP S SD++ + +SG S Sbjct: 157 GIDVNSLTSVESAPASYFSDKKGLNKSISLLSGDS 191 >At3g18550.1 68416.m02359 TCP family transcription factor, putative similar to teosinte branched1 protein GI:13649866 [Danthoniopsis dinteri] Length = 434 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = -1 Query: 297 SNRNPLLASALTIRRTCFLCSLFYIDDHSLMTEARFLRAPEISHRSLDEHVESEKSNTP 121 S+ P+L S T C L S++ +DD T R ++ RS+ + + TP Sbjct: 222 SHIRPVLGSMDTSSDLCELASMWTVDDRGSNTNTTETRGNKVDGRSMRGKRKRPEPRTP 280 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,767,116 Number of Sequences: 28952 Number of extensions: 217964 Number of successful extensions: 590 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -