BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0217 (557 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protei... 91 6e-19 At1g64410.1 68414.m07301 hypothetical protein 29 1.6 At1g52960.1 68414.m05990 hypothetical protein very low similarit... 29 1.6 At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) iden... 27 6.4 >At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protein similar to SP|P12048 Bifunctional purine biosynthesis protein purH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] {Bacillus subtilis}; contains Pfam profiles PF01808: AICARFT/IMPCHase bienzyme, PF02142: MGS-like domain Length = 596 Score = 90.6 bits (215), Expect = 6e-19 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%) Frame = +1 Query: 1 GSXG-KLALLSVSDKTGLLSLAKSLSECGLQLIASGGTATALRNAGLTVQDVSDITRAPE 177 GS G K AL+S+SDK L SL L E G ++++GGTA+ L NAG++V V +T PE Sbjct: 67 GSSGEKQALISLSDKRDLASLGNGLQELGYTIVSTGGTASTLENAGVSVTKVEKLTHFPE 126 Query: 178 MLGGRVKTLHPAVHAGILAR 237 ML GRVKTLHP +H GILAR Sbjct: 127 MLDGRVKTLHPNIHGGILAR 146 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 291 VXVCNLYPFVQTVSKPD-VTVADAVENIDIGGVTLLRA 401 V V NLYPF + V+ P ++ D +ENIDIGG ++RA Sbjct: 166 VVVVNLYPFYEKVTAPGGISFEDGIENIDIGGPAMIRA 203 >At1g64410.1 68414.m07301 hypothetical protein Length = 1231 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 407 KNHDRVTVVCXPADYDAVVKEIKENKHH 490 K HDRVTV P D D KE E K + Sbjct: 582 KGHDRVTVTVEPNDQDTAKKEKDEVKDY 609 >At1g52960.1 68414.m05990 hypothetical protein very low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 996 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 407 KNHDRVTVVCXPADYDAVVKEIKENKHH 490 K HDRVTV P D D KE E K + Sbjct: 208 KGHDRVTVTVEPNDQDTAKKEKDEVKDY 235 >At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) identical to RSH3 (RelA/SpoT homolog) GI:7141308 from [Arabidopsis thaliana]; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 712 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 39 QDGSTLVSKEPVGMWP--AVDCQWRYRHGASERRP 137 +DGS++ S EP+ +P A DC + Y+ ++ P Sbjct: 565 KDGSSICSSEPLCSFPSHAEDCPFSYKPSGNQEGP 599 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,427,238 Number of Sequences: 28952 Number of extensions: 190262 Number of successful extensions: 572 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -