BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0213 (511 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 29 2.9 08_01_0693 + 6131714-6132531,6133038-6135027 27 6.6 >10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 Length = 421 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 Query: 322 PVCWAPSXCPGSKD 281 PVCWAP PGS D Sbjct: 241 PVCWAPPSAPGSYD 254 >08_01_0693 + 6131714-6132531,6133038-6135027 Length = 935 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +2 Query: 92 RHWPVE--LNPGPGVGSKSPGDNHYR-LIXNGEVERYAPDQRYVVTLVGSRTHDVVQRLR 262 R W E + PG + G +++ L+ G ++ P+Q Y + G R HD++ L Sbjct: 447 RQWIAEGFVRSSPGQDLEDVGQSYFNELVNRGLIQ---PEQNYDREVTGCRVHDMMLDLI 503 Query: 263 ASK 271 SK Sbjct: 504 LSK 506 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,571,592 Number of Sequences: 37544 Number of extensions: 237183 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -