BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0210 (549 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 2.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.2 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 303 RSQQQRGA*TALRLVGYATRSVGSEKGQDV 214 RSQ + T++ Y+TR++ EKGQ + Sbjct: 289 RSQLEYDLQTSIMSRHYSTRAIVIEKGQSI 318 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 91 INTTPDFANFFAAPSSIKSA 150 +N PD N +A P+ KSA Sbjct: 1467 LNHYPDLHNLYAVPTDKKSA 1486 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 225 GQDVREITGVQLLEEAPRCLSS 160 GQ+V V LLE A RCL + Sbjct: 144 GQEVIYTACVGLLERAFRCLGN 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,730 Number of Sequences: 438 Number of extensions: 3165 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -