Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0207
         (557 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    21   7.2  

>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 14/63 (22%), Positives = 23/63 (36%)
 Frame = -2

Query: 319 LDGSISLSPLYPVPTIDLHVRMXRSSIRVSPDFDLTRHSSPSFGSQHLCSERAFIH*LET 140
           +D S + S  +   T D H     +   + P   L+     + G +HL   R     L  
Sbjct: 561 IDESSNSSNYFANKTYDFHNMSFENDFIIQPKHLLSIARQVALGMEHLAKTRVVHRDLAA 620

Query: 139 RRL 131
           R +
Sbjct: 621 RNV 623


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,900
Number of Sequences: 336
Number of extensions: 1692
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13681771
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)