Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0207
         (557 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_1091 + 30322035-30322739,30322861-30324043,30324114-303251...    27   7.7  

>03_05_1091 + 30322035-30322739,30322861-30324043,30324114-30325105,
            30326409-30326798,30326896-30330060
          Length = 2144

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +3

Query: 162  ARSEHKCWDPKDGELCLVRSKSGETLMEDRXILTCKSIVGTGYRGERL 305
            A+  +K W+ K GEL  V   +GET  + + +   + I+ T  + + L
Sbjct: 1393 AKERYKDWESKFGELARVVELTGETAADLKLLDKGEIIISTAEKWDAL 1440


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,532,312
Number of Sequences: 37544
Number of extensions: 207953
Number of successful extensions: 325
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 324
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 325
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1269546012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)