BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0206 (552 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 29 0.10 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 27 0.41 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 2.9 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 5.0 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 6.7 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.8 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 29.1 bits (62), Expect = 0.10 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +2 Query: 281 SEDGQDRGGVPHPQRADE*--LHRRHQGGSRRQDGDPRGKTRGLHQR 415 ++ G + GV PQ++ + HR+HQ +Q+G + + G+HQ+ Sbjct: 248 NQRGNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNGQQQQQRMGIHQQ 294 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 27.1 bits (57), Expect = 0.41 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 392 KTRGLHQRAA-LPSQGSS*GC*EDQVDPGTADRGSVQGHRDKM 517 +TR + +R LP +G+ G PGT DR S+Q D+M Sbjct: 2 ETRSMRKRTTRLPEEGAPTGA-----GPGTGDRASIQRLEDEM 39 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 2.9 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 309 SRIRSEQTNNFIVATKEAL-DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 485 S+ R + + + +E L DAK++ HE+ R E+ K + GV + + Q T Sbjct: 476 SKERIHELQSELDNVREQLGDAKIDKHEDARRKKKQEVVELFKLEVPGVYDRMINMCQPT 535 Query: 486 AEVY 497 + Y Sbjct: 536 HKRY 539 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 5.0 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = +1 Query: 16 DAVQLVRSLCRLKVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVG 156 D +LV S R +V T I + GG +EP+G Sbjct: 9 DDTELVNSTIRSEVTCPNHNISGTAIGTTNIQSGGDGVAAAASEPIG 55 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 6.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 158 TPTGSASITSYARPPFDISWQRISVDLVSTSMAST 54 TP S+ +ARP +++ +S+ +T +A T Sbjct: 650 TPNSVGSLQEFARPYRNMATTPVSIRFTNTVIART 684 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 8.8 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 193 TPSVEEIQETXKAAEERR 246 TP++EE++ + AE+R+ Sbjct: 298 TPAIEELENECRIAEQRQ 315 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,652 Number of Sequences: 2352 Number of extensions: 7405 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -