BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0205 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 26 0.19 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 1.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 3.1 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 26.2 bits (55), Expect = 0.19 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = +3 Query: 354 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKPSKIR*PQ 533 + + +D K E H+E+ A + E+R+ + +G+ T L + VY + P Sbjct: 172 IVGESVIDEKAEEHKEQFTALVREIRNAFRH--DGLLLTMSVLPNVNSSVYYDPRALAPN 229 Query: 534 L 536 L Sbjct: 230 L 230 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +1 Query: 70 AMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSP 195 A T T+++ + S V A P G+P P + SP Sbjct: 194 ASRTTTSPTKVKASKASPAAAPRSV--ATPTGIPTPSTSASP 233 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 197 SGESARRGTGTPTGSASITSYARPP 123 S +A R TPTG + ++ A PP Sbjct: 210 SPAAAPRSVATPTGIPTPSTSASPP 234 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 3.1 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = +3 Query: 354 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKPSKIR*PQ 533 VA + LD H E+ + + ELR K E + T L + VY + P Sbjct: 180 VAGDKVLDENAAEHREQFVSLVRELRGAFK--AENLLVTLTVLPNVNSTVYYDPRALSPN 237 Query: 534 L 536 L Sbjct: 238 L 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,696 Number of Sequences: 336 Number of extensions: 1568 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -