BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0205 (560 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 30 0.27 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 28 1.1 SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch... 27 2.5 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 26 3.3 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 26 3.3 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 25 5.8 SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosacchar... 25 5.8 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 25 7.6 SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces p... 25 7.6 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 29.9 bits (64), Expect = 0.27 Identities = 12/57 (21%), Positives = 31/57 (54%) Frame = +3 Query: 339 TNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYK 509 T N I++ + + + HEE + ELR++++++++ E+ ++ E+Y+ Sbjct: 85 TLNNILSMRTETGSMAKAHEEVSQQINTELRNKIREYIDQTEQQKVVAANAIEELYQ 141 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 27.9 bits (59), Expect = 1.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 19 SSDAIQLFRSLCRLKVEAMEVETKSTEIRCQEMSKGGLAYE 141 S D L+ L R + +E E ++ +C E K L YE Sbjct: 2534 SLDEHDLYHGLWRRRANFLETEVATSHEQCHEWEKAQLVYE 2574 >SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1822 Score = 26.6 bits (56), Expect = 2.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 4 IRHERSSDAIQLFRSLCRLKVEAMEVETKSTEIRCQEM 117 + + DA +FRS+CRL V + K + IR Q M Sbjct: 381 VENSSIQDAFLVFRSMCRLAVRQTSPD-KVSNIRSQAM 417 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 26.2 bits (55), Expect = 3.3 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 333 EQTNNFIVATKEA-LDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAE 500 +Q VA ++A +E K E + + + SR+K + +E TRL + Q E Sbjct: 460 KQVEELTVALNSGKMNAIVEAESSKNELWDSMMVSRMKTQEQSIELTRLYKQLQDIE 516 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 26.2 bits (55), Expect = 3.3 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +3 Query: 366 EALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ 488 E L K+++ ++++ INEL R+K + V + T+++ Sbjct: 530 EGLTLKIDSITKEKDRLINELEQRIKSYEVNVSELNGTIDE 570 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.4 bits (53), Expect = 5.8 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 70 AMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPS 210 A+ ETKST ++ GG A +A P +P P +P P+ Sbjct: 867 AITPETKST---VNQIMSGGEALAAPVAVPAPIPAPVAEPAPPAAPA 910 >SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 289 Score = 25.4 bits (53), Expect = 5.8 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 357 ATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ--QTAEVYKPSKIR*P 530 A +E + ++E +EA +NE R L+ LEG ++ L++ Q + YK + R Sbjct: 5 AVRERRQFIYKRNQELQEAKLNEKRRALRKALEGNKELNKDLQEDSQLQKDYKYDESRAT 64 Query: 531 QLPT 542 Q T Sbjct: 65 QEET 68 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 25.0 bits (52), Expect = 7.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 351 IVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEK 467 I+A + L A+ E +E+ E +NE R+K+ E +K Sbjct: 1592 ILAARSELVAEKEKTKEELENQLNEKSQRIKELEEQAQK 1630 >SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.0 bits (52), Expect = 7.6 Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = +3 Query: 330 SEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYK 509 SEQT A + + K E E L++ KD+ ++K LE++ + K Sbjct: 391 SEQTQLVEEALTKVMKEKYREKENNLELLETNLKTHHKDYKHALKKRITALEEEKNRLIK 450 Query: 510 ---PSKIR 524 P K++ Sbjct: 451 EIGPEKVK 458 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,761,708 Number of Sequences: 5004 Number of extensions: 26995 Number of successful extensions: 122 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -