BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0205 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 31 0.020 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 29 0.10 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 3.0 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 6.8 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 31.5 bits (68), Expect = 0.020 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 401 KTRGLHQRAA-LPSQGSS*GR*EDQVDPGTADRGSVQAIEDKM 526 +TR + +R LP +G+ G PGT DR S+Q +ED+M Sbjct: 2 ETRSMRKRTTRLPEEGAPTG-----AGPGTGDRASIQRLEDEM 39 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 29.1 bits (62), Expect = 0.10 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +2 Query: 290 SEDGQDRGGVPHPQRADE*--LHRRHQGGSRRQDGDPRGKTRGLHQR 424 ++ G + GV PQ++ + HR+HQ +Q+G + + G+HQ+ Sbjct: 248 NQRGNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNGQQQQQRMGIHQQ 294 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 3.0 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 318 SRIRSEQTNNFIVATKEAL-DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 494 S+ R + + + +E L DAK++ HE+ R E+ K + GV + + Q T Sbjct: 476 SKERIHELQSELDNVREQLGDAKIDKHEDARRKKKQEVVELFKLEVPGVYDRMINMCQPT 535 Query: 495 AEVY 506 + Y Sbjct: 536 HKRY 539 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 6.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 167 TPTGSASITSYARPPFDISWQRISVDLVSTSMAST 63 TP S+ +ARP +++ +S+ +T +A T Sbjct: 650 TPNSVGSLQEFARPYRNMATTPVSIRFTNTVIART 684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,536 Number of Sequences: 2352 Number of extensions: 7281 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -