BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0205 (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 29 2.8 At1g40133.1 68414.m04768 hypothetical protein 29 2.8 At5g61040.1 68418.m07660 expressed protein 27 6.5 At5g08780.1 68418.m01041 histone H1/H5 family protein contains P... 27 6.5 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 359 HQGGSRRQDGDPRGKTRGLHQRAALPSQGSS*G 457 HQGG+ R + RG+ RG + + PS G G Sbjct: 86 HQGGAGRDNDGDRGRDRGYDRDRSRPSGGRGGG 118 >At1g40133.1 68414.m04768 hypothetical protein Length = 663 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 336 QTNNFIVATKEALDAKMETHEEKREAYINE 425 + NN A +A AKME E +REA++N+ Sbjct: 474 EANNRDEALSQAAAAKMEKEEVEREAFVNK 503 >At5g61040.1 68418.m07660 expressed protein Length = 590 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 330 SEQTNNFIVATKEALDA-KMETHEEKREAYINELRSRLKDHLEGVEKTR 473 S ++F V +E LD +E EEK ++NE+ +L + VEKT+ Sbjct: 521 SHHKDDFKVQEQELLDLIGIEDEEEKSSDFVNEMEKQLIKQI--VEKTK 567 >At5g08780.1 68418.m01041 histone H1/H5 family protein contains Pfam domain, PF00538: linker histone H1 and H5 family Length = 457 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 64 VEAMEVETKSTEIRCQEMSKGGLAYEV 144 VE ++VE E R + S+GG YEV Sbjct: 229 VEVVDVENSENEARIEANSRGGELYEV 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,763,570 Number of Sequences: 28952 Number of extensions: 162062 Number of successful extensions: 680 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -