BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0204 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) 29 1.9 SB_22106| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 >SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) Length = 905 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +2 Query: 128 QIKRCLTPRKTCYCSSTVPQSH-----ASCKREKRRQYSIFLTITTRXVP 262 Q+++C + T YCS P+SH A CK +K + S L ++T P Sbjct: 17 QLQKCSRCKSTMYCSKDCPRSHWKHHKAICKAKKHSKDS-KLDVSTTTAP 65 >SB_22106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 143 LTPRKTCYCSSTVPQSHASCKREKRRQYSIFLTITTRXVPACV 271 L P+ T SH SC+R Y IF T+ +PA + Sbjct: 162 LLPQMGWTNGKTYISSHGSCRRPLSDDYLIFSTVAHFCIPAAI 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,446,389 Number of Sequences: 59808 Number of extensions: 264939 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -