BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0204 (552 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 101 5e-24 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 4.8 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 101 bits (242), Expect = 5e-24 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 1/112 (0%) Frame = +1 Query: 139 MSDAKKNLLLFFDRPSEPCFMQKGEEKAVFDIPDNYYPEX-TSVCQML*ATGSVATRXRM 315 M+ K +L FDRPSEP ++ KG+ K FDIP +Y P+ SV + T ++ Sbjct: 1 MASDKSGILYLFDRPSEPVYVPKGDNKVAFDIPPDYLPDRYRSVATQVFNRFGDDTESKL 60 Query: 316 IPIRNIALPNLDLPMELPYNEQFSLFVPKHRQMAGKLIDIFMGMRDVEDLQS 471 P++ I LP+L +PM+L + FSLF+P HR++A +LIDIFMGMR ED S Sbjct: 61 -PVKAITLPDLSIPMQLGRRQPFSLFIPAHRKIAARLIDIFMGMRTYEDFLS 111 Score = 25.0 bits (52), Expect = 0.51 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 510 FNYCLSVAILHRSD 551 F Y LSVAILHR D Sbjct: 125 FIYALSVAILHRPD 138 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 516 YCLSVAILHRSD 551 Y LSVA++HR D Sbjct: 140 YALSVAVIHRPD 151 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 516 YCLSVAILHRSD 551 Y LSVA++HR D Sbjct: 140 YALSVAVIHRPD 151 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 366 QLHGQVQIGQGNVPDGYHAAPRXYRTC 286 QL+ VQ G G+ P H + TC Sbjct: 266 QLNSDVQPGHGSPPVKQHRSSSASTTC 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,947 Number of Sequences: 438 Number of extensions: 3189 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -