BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0202 (555 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase f... 30 0.90 At1g51900.1 68414.m05850 hypothetical protein 29 1.6 At4g05280.1 68417.m00799 Ulp1 protease family protein contains P... 29 2.8 At3g43390.1 68416.m04592 hypothetical protein similar to At3g243... 29 2.8 At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containi... 29 2.8 At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative si... 28 4.8 At5g20540.1 68418.m02439 expressed protein 27 8.4 At4g15820.1 68417.m02407 wound-responsive protein-related contai... 27 8.4 At1g34740.1 68414.m04319 Ulp1 protease family protein contains P... 27 8.4 At1g34160.1 68414.m04237 pentatricopeptide (PPR) repeat-containi... 27 8.4 At1g25886.1 68414.m03180 Ulp1 protease family protein contains P... 27 8.4 >At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase family protein / UPP synthetase family protein contains putative undecaprenyl diphosphate synthase domain [PF01255]; similar to S. cerevisiae dehydrodolichyl diphosphate synthetase (DEDOL-PP synthase)(Rer2)[SP|P35196], a cis-prenyltransferase Length = 271 Score = 30.3 bits (65), Expect = 0.90 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -3 Query: 220 LLSGNVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLG 101 ++ GN +KHNL IG+D AG + + LQ C ++G Sbjct: 41 IMDGNRRFAKKHNL-IGLDAGHRAGFISVKYILQYCKEIG 79 >At1g51900.1 68414.m05850 hypothetical protein Length = 774 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 220 DPEVFIRRYREVDSSQLKHTETQXKNPLPDKDAIEAEK 333 DP+++IR Y E + K + T + + + D+IE K Sbjct: 362 DPDIYIRSYEESPNEVYKFSLTDLEEEIMENDSIEGVK 399 >At4g05280.1 68417.m00799 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At1g25886, At4g03300 Length = 1312 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/73 (23%), Positives = 32/73 (43%) Frame = +1 Query: 232 FIRRYREVDSSQLKHTETQXKNPLPDKDAIEAEKEKNKFLXGIENFDPTKLKHTETCXKN 411 + R +++ QL+ T+ + K P E +K I D K ++ E C Sbjct: 348 YARVPKQLRPPQLEETDVKRKRNAPGPSPKEPAMKKQ-----ISEMDCDKEENAEDCFGE 402 Query: 412 PLPXKDVIEQEKS 450 P+P + ++E +S Sbjct: 403 PVPERFIVEMRRS 415 >At3g43390.1 68416.m04592 hypothetical protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1113 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/73 (23%), Positives = 32/73 (43%) Frame = +1 Query: 232 FIRRYREVDSSQLKHTETQXKNPLPDKDAIEAEKEKNKFLXGIENFDPTKLKHTETCXKN 411 + R +++ QL+ T+ + K P E +K K D K ++ E C Sbjct: 402 YARVPKQLCPPQLEETDVKRKRNAPGPSPKEPAMKKQK-----SEMDCDKEENAEDCFGE 456 Query: 412 PLPXKDVIEQEKS 450 P+P + ++E +S Sbjct: 457 PVPERFIVEMRRS 469 >At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 786 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +2 Query: 68 SVSDTPSLKDLPKVATDLKSQLEGF---NTSCLRDVDTNEKIVLPSAEDVATEKTQKS 232 S+ + + DLPK+ + SQ E + S +DT E ++ P+AED E S Sbjct: 78 SLEEVTNADDLPKIDDEKNSQFETSPHPSPSPSVALDTEEGLINPTAEDTVEENIVSS 135 >At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase isoform 1, Citrus unshiu, PIR:S72648 Length = 894 Score = 27.9 bits (59), Expect = 4.8 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 68 SVSDTPS--LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATEK 220 S SD+PS L+D+ ++ +LK L+G + VDTN AED A E+ Sbjct: 532 SDSDSPSDSLRDINDISLNLKLSLDGEKSGSNNGVDTN-----LDAEDRAAER 579 >At5g20540.1 68418.m02439 expressed protein Length = 384 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 71 VSDTPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 217 ++ TP + + T+ S +S RD D +E++ + +A DV E Sbjct: 282 LNSTPKVSSISVAKTETSSIDASIRSSSSRDADRSEEMSVSNASDVDNE 330 >At4g15820.1 68417.m02407 wound-responsive protein-related contains weak similarity to KED [Nicotiana tabacum] gi|8096269|dbj|BAA95789 Length = 460 Score = 27.1 bits (57), Expect = 8.4 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 44 IY*FRMACSV---SDTPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNEKI 184 I+ F+ C+V D+ + P+V++D EG N L DV+ NEKI Sbjct: 92 IFAFQTVCAVLFLGDSTKSEKTPEVSSDS----EGNNLVLLEDVEMNEKI 137 >At1g34740.1 68414.m04319 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1383 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = +1 Query: 265 QLKHTETQXKNPLPDKDAIEAEKEKNKFLXGIENFDPTKLKHTETCXKNPLPXKDVIEQE 444 QL+ T+ + K P E +K K D K + E C P+P + ++E Sbjct: 393 QLEETDVKRKRNAPGPSPKEPAMKKQK-----SEMDCDKEETAEDCFGEPVPERFIVEMR 447 Query: 445 KS 450 +S Sbjct: 448 RS 449 >At1g34160.1 68414.m04237 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 558 Score = 27.1 bits (57), Expect = 8.4 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = -3 Query: 229 LLGLLSGNVFSRRKHNLFIGVDVTETAGVEAFELT----LQVCGDLGEVFQGGSVTHGAG 62 + GL+SGN S L+ + ET G+ E+T L C LG+V +G ++ HG Sbjct: 182 IAGLVSGNRASEAME-LYKRM---ETEGIRRSEVTVVAALGACSHLGDVKEGENIFHGYS 237 Query: 61 HSESI 47 + I Sbjct: 238 NDNVI 242 >At1g25886.1 68414.m03180 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At4g03300 Length = 1201 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = +1 Query: 265 QLKHTETQXKNPLPDKDAIEAEKEKNKFLXGIENFDPTKLKHTETCXKNPLPXKDVIEQE 444 QL+ T+ + K P E +K K D K + E C P+P + ++E Sbjct: 380 QLEETDVKRKRNAPGPSPKEPAMKKQK-----SEMDCDKEETAEDCFGEPVPERFIVEMR 434 Query: 445 KS 450 +S Sbjct: 435 RS 436 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,277,798 Number of Sequences: 28952 Number of extensions: 200603 Number of successful extensions: 654 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -