BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0200 (552 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 27 0.41 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 26 0.95 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 27.1 bits (57), Expect = 0.41 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = -1 Query: 396 SLVALVLATPKSLLAK-HWYSPSSEALVWLNTREPASIVVSVSRPTLKSXRLFATSXRHH 220 SL A +L +PKS A H SP +E + N + ++++ + P T + Sbjct: 420 SLYATILKSPKSPTATTHLISPPAE---FSNGSSKSLLLLNGNGPPPPVPERSKTP--NS 474 Query: 219 CXLPXXRTPAXXPVPFXTXPXPVA 148 L TP PVPF P P A Sbjct: 475 IYLSQNGTPRSTPVPFALAPPPAA 498 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 25.8 bits (54), Expect = 0.95 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 474 RSSK-GFPSTTVTFFSSNAGVSMYVRRSLVALVLATPK 364 RS K G PST V+ S+N S R+ V L LA+P+ Sbjct: 189 RSLKSGNPSTAVSSSSTNNNTSNISNRNQVNLPLASPE 226 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,220 Number of Sequences: 2352 Number of extensions: 8404 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -