BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0199 (539 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02900.1 68418.m00233 cytochrome P450, putative cytochrome P4... 29 2.0 At1g67025.1 68414.m07621 hypothetical protein 29 2.6 At4g15490.1 68417.m02367 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.5 At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.6 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 27 6.1 At5g13520.1 68418.m01561 peptidase M1 family protein similar to ... 27 6.1 At4g14780.1 68417.m02273 protein kinase, putative similar to pro... 27 6.1 At1g50240.1 68414.m05633 armadillo/beta-catenin repeat family pr... 27 8.0 >At5g02900.1 68418.m00233 cytochrome P450, putative cytochrome P450 homolog, Arabidopsis thaliana, PIR:T09367 Length = 480 Score = 29.1 bits (62), Expect = 2.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 247 VFSPRVFDTTVVSLCGALQPRGLSL 173 VF +FDTT+V++ G+ PR LS+ Sbjct: 143 VFKRFMFDTTLVTVTGSADPRSLSI 167 >At1g67025.1 68414.m07621 hypothetical protein Length = 221 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +3 Query: 90 LFTLRGSPLIPETRFPFSRRHRPRYCSERDRPRGWSAPQRETTVVSN 230 + L G L+P +PF ++P YC + + Q T V++N Sbjct: 5 IIKLEGPRLLPNVTYPFWGVNKPNYCGQTEFQLTCKNNQNLTLVLTN 51 >At4g15490.1 68417.m02367 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase ;simalr to UDP-glucose:sinapate glucosyltransferase GI:9794913 from [Brassica napus] Length = 479 Score = 28.3 bits (60), Expect = 3.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = -1 Query: 335 PSSEALVWLNTREPASIV 282 P+S+ + WL++REP+S+V Sbjct: 266 PASDCMEWLDSREPSSVV 283 >At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 475 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -1 Query: 335 PSSEALVWLNTREPASIV 282 P S+ + WL++REP+S+V Sbjct: 262 PDSDCIEWLDSREPSSVV 279 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 27.5 bits (58), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 232 VFDTTVVSLCGALQPRGLSLSEQYLGRCLLENGNLVS 122 VFDT + +CG L+ G L+ + C+ + + V+ Sbjct: 425 VFDTRTLEICGTLRASGNRLASNWSRSCISPDDDYVA 461 >At5g13520.1 68418.m01561 peptidase M1 family protein similar to SP|P09960 Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) {Homo sapiens}; contains Pfam profile PF01433: Peptidase family M1 Length = 616 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 404 VRRXLVALVLATXKSLLAKHWXSPSSEALVWLN 306 +R V +VL+ SLL + SPS+ AL WL+ Sbjct: 81 IRGTEVVVVLSGQSSLLIVYSTSPSASALQWLS 113 >At4g14780.1 68417.m02273 protein kinase, putative similar to protein kinase ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 364 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 358 SDFXVASTRATXLRRTYIETPAFEEKKVTVVEGKPFELRCPVF 486 +DF VA A + ET V++GKP+ RC V+ Sbjct: 223 ADFGVARVEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVY 265 >At1g50240.1 68414.m05633 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 1021 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 166 QYLGRCLLENGNLVSGINGLPRSV 95 Q L RC L NG L S + GLP S+ Sbjct: 342 QLLSRCCLHNGILPSMLCGLPSSL 365 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,985,699 Number of Sequences: 28952 Number of extensions: 214819 Number of successful extensions: 610 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -