BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0197 (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_44841| Best HMM Match : 7tm_1 (HMM E-Value=4.79999e-40) 54 1e-07 SB_39190| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) 33 0.16 SB_54730| Best HMM Match : RdRP (HMM E-Value=0) 31 0.64 SB_1137| Best HMM Match : CC (HMM E-Value=2) 31 0.64 SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_56601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 4.5 SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) 28 4.5 SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) 28 4.5 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) 27 7.9 SB_17636| Best HMM Match : RPE65 (HMM E-Value=7.8e-12) 27 7.9 >SB_25385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 77.8 bits (183), Expect = 6e-15 Identities = 33/71 (46%), Positives = 46/71 (64%) Frame = +2 Query: 44 SPPQWSPVYTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTSAVYPPYG 223 +PP W YT+ G+L +PYAE+ EPF AW+D +SRIDYYGGM T+Q + G Sbjct: 337 TPPTWPQEYTLTGVLRLPYAEIEEPFQAWFDGGRKRSRIDYYGGMDSTFQRGDIL--TAG 394 Query: 224 TSIKIAPVTTE 256 + +I P++TE Sbjct: 395 ANFRICPMSTE 405 Score = 59.3 bits (137), Expect = 2e-09 Identities = 30/83 (36%), Positives = 40/83 (48%) Frame = +1 Query: 256 TEMNKETCLQVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKY 435 T++N +C Q N T QSVLPD+ F ++G T D + W+ VG K NKY Sbjct: 406 TKLNVRSCFQTNGTSASPVGPQSVLPDLAKFSFVGNSTYGDVKCSIWEYKLTVGHKRNKY 465 Query: 436 TMWVKYKKTLKGDSVPIPVRYEM 504 TM+ P P+ YEM Sbjct: 466 TMYTSM------HDPPAPIHYEM 482 Score = 30.7 bits (66), Expect = 0.84 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 510 FNSLLGSHYDHYYLDY 557 F+ L+GSHYD Y LDY Sbjct: 485 FDDLIGSHYDQYELDY 500 >SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 62.5 bits (145), Expect = 2e-10 Identities = 29/64 (45%), Positives = 38/64 (59%) Frame = +2 Query: 68 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTSAVYPPYGTSIKIAPV 247 Y G+L++PY ++ EPF WY + SRIDYYGGM +TYQ YG + KI P Sbjct: 39 YHATGVLSLPYGDIKEPFEVWYSGLHGMSRIDYYGGMDRTYQ--RGDLGKYGYACKIVPE 96 Query: 248 TTEL 259 +EL Sbjct: 97 FSEL 100 Score = 55.6 bits (128), Expect = 3e-08 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +2 Query: 68 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQ 193 Y G+L +P +E++EPF W+ +++SRIDYYGG VKTYQ Sbjct: 902 YHATGVLRLPTSEVNEPFEIWFSRPHNQSRIDYYGGDVKTYQ 943 >SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 58.4 bits (135), Expect = 4e-09 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 5/78 (6%) Frame = +2 Query: 38 KGSPPQWSPV-----YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTS 202 + +PP P Y G L +P++++ EPF W+ +++++SRIDYY G +T+Q Sbjct: 37 RSAPPPMKPFHFPRNYHATGKLQLPHSKIEEPFEVWFSAQHNRSRIDYYYGTDRTFQ--R 94 Query: 203 AVYPPYGTSIKIAPVTTE 256 A P+G + KI P+ T+ Sbjct: 95 ADVGPHGEAFKIVPIYTD 112 Score = 52.4 bits (120), Expect = 2e-07 Identities = 28/77 (36%), Positives = 39/77 (50%) Frame = +1 Query: 277 CLQVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYK 456 C + T+ +Q ++P+MTDFK+ G E A TAKW+ +N +T+WV Sbjct: 120 CWHLEGTERTPIVVQPIVPNMTDFKFAGYEVYHGASTAKWEYRYLAFGLMNAHTIWVTTA 179 Query: 457 KTLKGDSVPIPVRYEMK 507 P PVRYEMK Sbjct: 180 ------DPPRPVRYEMK 190 >SB_44841| Best HMM Match : 7tm_1 (HMM E-Value=4.79999e-40) Length = 1198 Score = 53.6 bits (123), Expect = 1e-07 Identities = 25/59 (42%), Positives = 34/59 (57%) Frame = +2 Query: 68 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTSAVYPPYGTSIKIAP 244 Y G L++PY + EPF +WY + SRIDYY GM KT+Q + YG +K+ P Sbjct: 1020 YHAIGTLHLPYDNIREPFESWYARDYNMSRIDYYYGMDKTFQRGDLM--DYGVLVKVVP 1076 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 68 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMV 181 Y V+G L++PY E+ EPF AWY + SRIDYY G V Sbjct: 878 YRVQGTLSLPYDEIVEPFEAWYAGDYNMSRIDYYYGKV 915 Score = 35.1 bits (77), Expect = 0.039 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 319 QSVLP-DMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYKK 459 QSVLP + FK+IG E T K+Q + K N YT W+ K Sbjct: 1106 QSVLPAHLEHFKFIGEEIRSGMPTFKYQRNTTIFHKKNSYTFWMTKAK 1153 Score = 27.5 bits (58), Expect = 7.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 510 FNSLLGSHYDHYYLDY 557 +++LL S YDHY +DY Sbjct: 1165 YDTLLNSFYDHYVMDY 1180 >SB_39190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 47.6 bits (108), Expect = 7e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = +2 Query: 68 YTVKGLLNIPYAELHEPFYAWYDSKNSKSRIDYYGG 175 Y V+G L++PY E+ EPF AWY + SRIDYY G Sbjct: 72 YRVQGTLSLPYDEIVEPFEAWYAGDYNMSRIDYYYG 107 >SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) Length = 936 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 477 RIPFQSLLVFNPHRVFV*LIADRLYHL 397 +I F S +VF PHR ++ L+ DRLYHL Sbjct: 525 QIVFPSHIVFTPHRSYL-LLTDRLYHL 550 >SB_54730| Best HMM Match : RdRP (HMM E-Value=0) Length = 658 Score = 31.1 bits (67), Expect = 0.64 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 244 GHNGTEMNKETCLQVNSTQDQLQDIQSVLPDMTDFKYIGT 363 GH+ +++ +TC +N T ++I S+L TDF I T Sbjct: 103 GHSNSQLKDKTCFLMNGTH---EEIHSLLAQFTDFSKIKT 139 >SB_1137| Best HMM Match : CC (HMM E-Value=2) Length = 410 Score = 31.1 bits (67), Expect = 0.64 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +1 Query: 319 QSVLP-DMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYKKTLKGDSVPIPVR 495 QSV+P ++T+FK + ET + + ++Q +K N Y +W+ K + P+R Sbjct: 232 QSVVPTNLTEFKMVAIETHRGHPSFRFQRKFSELNKTNTYILWITTHKPHR------PLR 285 Query: 496 YEM 504 +EM Sbjct: 286 FEM 288 Score = 29.1 bits (62), Expect = 2.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 510 FNSLLGSHYDHYYLDY 557 ++ +L SHYDHY +DY Sbjct: 291 YDDMLTSHYDHYLIDY 306 >SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 328 LPDMTDFKYIGTET-MQDADTAKWQMVQPVGDKLN--KYTMWVKYKKTLKGDSVPIPVRY 498 LP +D K+ T Q ++ KW P N T+ V+Y+ G S+ +PVRY Sbjct: 186 LPSPSDIKWSVPYTPRQISNDIKWSDPYPPRQISNGRSLTLSVRYQMISNGRSLTLPVRY 245 Query: 499 EM 504 +M Sbjct: 246 QM 247 >SB_56601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.5 bits (63), Expect = 1.9 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 510 FNSLLGSHYDHYYLDY 557 +++LL S+YDHY LDY Sbjct: 48 YDTLLSSYYDHYILDY 63 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 35 DKGSPPQWSPVYTVKGLLNI 94 DKGSPPQ+S + + +LNI Sbjct: 451 DKGSPPQYSEITVIVKVLNI 470 >SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) Length = 338 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 131 YDSKNSKSRIDYYGGMVKTYQF-TSAVYPPYGTSIKIAPVTTEL 259 Y+ + R + YG ++ + TS Y PYGTS++ P T L Sbjct: 294 YNPYGTSLRYNPYGTSLRYNPYGTSLRYSPYGTSLRYNPYGTSL 337 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 155 RIDYYGGMVKTYQF-TSAVYPPYGTSIKIAPVTTEL 259 R + YG ++ + TS Y PYGTS++ +P T L Sbjct: 293 RYNPYGTSLRYNPYGTSLRYNPYGTSLRYSPYGTSL 328 >SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) Length = 317 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 283 QVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQM--VQPVGDKLNKYTMWV 447 Q T + QD +S ++D KYIG + + T +W + +P +L+ + WV Sbjct: 153 QEGYTGELCQDCKSPPIGISDEKYIGNSRIAGSSTGQWVLDYFEPYKGRLHGPSSWV 209 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 27.5 bits (58), Expect = 7.9 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +2 Query: 95 PYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTS---AVYPPYGTSIKIA 241 PY+ +H P Y YD++ + YYG + Q + V PPY IA Sbjct: 21 PYSSVHFPVYGQYDARQER----YYGPPLPRSQHPTRQDMVKPPYSYIALIA 68 >SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) Length = 1033 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 347 LNISAQKQCRMPTRPNGRWYSRSAIS 424 L+ S++ CR PTRP R++S +A+S Sbjct: 34 LDESSRDVCRFPTRPLIRYFSFTALS 59 >SB_17636| Best HMM Match : RPE65 (HMM E-Value=7.8e-12) Length = 366 Score = 27.5 bits (58), Expect = 7.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -1 Query: 537 RSGSPGAN*NFHLISDRYGHRIPFQSLLVFN 445 R G PG N+ + S R G+ +P++ ++ F+ Sbjct: 238 RHGMPGTRYNYLMASARPGYNLPYRDIVKFD 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,005,099 Number of Sequences: 59808 Number of extensions: 404042 Number of successful extensions: 1301 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -