BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0195 (558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 6.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 6.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.4 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 159 YYSNPSYDAYE 191 YY PSYDA E Sbjct: 409 YYLKPSYDAQE 419 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 53 AEHVRHLLHPDDLSAHPPRRLPSLQERKRF 142 AE+ R+ + P R+P LQE F Sbjct: 257 AEYRRNFKKMQEEKIFEPHRIPQLQEVSEF 286 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +3 Query: 90 SAPTRLDDFQVFRRGNASHIYGNYYSNPSYDAYEEPEIE 206 S+P D +++ + H + Y Y YE P+ E Sbjct: 59 SSPPEHRDLPIYQSHHHLHHHQVLYQQSPYLMYENPDEE 97 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 362 TVYRIH*YLCSGLCRLSTKLYHLR 291 T+ R+ +CSG C+L+ L +R Sbjct: 233 TITRVIPQVCSGNCKLNDILLTVR 256 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 362 TVYRIH*YLCSGLCRLSTKLYHLR 291 T+ R+ +CSG C+L+ L +R Sbjct: 233 TITRVIPQVCSGNCKLNDILLTVR 256 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,226 Number of Sequences: 438 Number of extensions: 3064 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -