BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0194 (551 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016675-5|AAB66134.1| 476|Caenorhabditis elegans Hypothetical ... 28 3.9 AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical... 27 6.8 >AF016675-5|AAB66134.1| 476|Caenorhabditis elegans Hypothetical protein T27B7.2 protein. Length = 476 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 310 FRRSPNRSWNT*KREI*NGNKTRMYKRRYHFRECL 414 FRRS W K + GNK R + R R CL Sbjct: 68 FRRSSKSKWINKKCQSKTGNKARCFCRPCRLRRCL 102 >AL031627-15|CAA20966.1| 318|Caenorhabditis elegans Hypothetical protein Y102A5C.25 protein. Length = 318 Score = 27.5 bits (58), Expect = 6.8 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 245 YTFCIVYNLLNKQTHFFAAVFCCSSDIFVYISLFVSVLHICLNIHVTQAYGI 90 Y IVY L+ T F + SD V IS + L+ LNI +TQ + + Sbjct: 68 YKMVIVYYLIFISTCFGVFFYPYLSDSIVLISFIIQGLYSSLNI-ITQVFHV 118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,534,425 Number of Sequences: 27780 Number of extensions: 260845 Number of successful extensions: 828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -