BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0194 (551 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18260.1 68414.m02277 suppressor of lin-12-like protein-relat... 31 0.51 At1g33050.2 68414.m04070 expressed protein 27 6.3 At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family pr... 27 8.3 >At1g18260.1 68414.m02277 suppressor of lin-12-like protein-related / sel-1 protein-related similar to Sel-1 homolog precursor (Suppressor of lin-12-like protein) (Sel-1L)(SP:Q9UBV2) {Homo sapiens} Length = 678 Score = 31.1 bits (67), Expect = 0.51 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = +2 Query: 305 PVFEDLQIEAGIPENERFKTVTKQECTKDVIILENVCKKG-YKTYYRMDVVSPKFAELAI 481 PV E +I +G EN+ ++ E +D ILE +KG Y++ + F + Sbjct: 201 PVVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQKGNANAMYKIGL----FYYFGL 256 Query: 482 KELARFH--GLHWFWKS 526 + L R H LHWF K+ Sbjct: 257 RGLRRDHTKALHWFLKA 273 >At1g33050.2 68414.m04070 expressed protein Length = 607 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -2 Query: 349 VFRYSSFDLEIFENRTELSISQCF 278 V +Y+S+DL++ N++++ S CF Sbjct: 577 VAQYNSYDLKLLPNKSKVCCSNCF 600 >At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 421 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 275 LQRYLRPI---NTYTFCIVYNLLNKQTHFFAAVFCCSSDIFV 159 ++ +LRP T+ C+++ L + + F V CC S ++ Sbjct: 10 VKEFLRPFVDSRTWDLCVIWKLGDDPSRFIEWVGCCCSGCYI 51 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,614,650 Number of Sequences: 28952 Number of extensions: 229703 Number of successful extensions: 715 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -