BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0193 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 25 0.27 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.4 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 4.4 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 25.4 bits (53), Expect = 0.27 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 202 TNRNGSKDYGL-FQINDRYGAAKVPVQAKTATLSAPTSXTDDITK 333 T + + YG+ I D YG K+PV K S PT D K Sbjct: 238 TQKTQGQIYGIKVDIRDAYGNVKIPVLCKLIQ-SIPTHLLDSEKK 281 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 255 WCSKGASPGK 284 W KGA PGK Sbjct: 2549 WIEKGADPGK 2558 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 119 FLSSCTRPHLVNVLASEPTQ 60 +LS+ R HL +++ PTQ Sbjct: 64 YLSAPEREHLASIIRLTPTQ 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,496 Number of Sequences: 336 Number of extensions: 1546 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -