BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0191 (880 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 26 1.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.3 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 7.0 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.3 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.8 bits (54), Expect = 1.7 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +3 Query: 90 ITLKPILKECEASPTMIGGLFVYNHKGEVLISRVYR--DDIGRNAVDAF-RVNVIHARSR 260 ITL+ + C S ++ H +L+S +YR + G AVD+ RV V+ A SR Sbjct: 3 ITLQINISNCSTSQNLMLQAAKEQHADVILVSELYRHPPNNGNWAVDSSGRVAVVAAGSR 62 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 156 YNHKGEVLISRVYRDDIGRN 215 YNH E ++ V+ + IGRN Sbjct: 1710 YNHVAESILHAVHDEPIGRN 1729 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -1 Query: 343 LCDCCQPNICTLDM--EERCAC 284 LC CC+ + C +M CAC Sbjct: 779 LCHCCEFDACDCEMTCPNNCAC 800 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 656 TAPFRLVLKCLSRRPAQSDQLL 591 T P L+L+C+ +P+ QLL Sbjct: 233 TKPTELILECIPPKPSNLTQLL 254 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 9.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 216 HYDQYHLGRLSRSTPRLYGCKRTSLRSL 133 HY Q+H Y C RT ++SL Sbjct: 762 HYAQHHFNSQGSRKAEPYYCDRTLVQSL 789 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 888,403 Number of Sequences: 2352 Number of extensions: 18370 Number of successful extensions: 60 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -