BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0191 (880 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.6 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 8.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 8.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 8.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 8.6 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/51 (21%), Positives = 23/51 (45%) Frame = +2 Query: 227 IQSECDPCSQQVRSPVTNIARTSFFHIKRANIWLAAVTKQNVNAAMVFEFL 379 +++EC PCS++ + + + F + IW+ K + A +L Sbjct: 71 LENECSPCSEKQKKIADKVVQ--FLIDNKPEIWVLLEAKYDPTGAYKQHYL 119 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/51 (21%), Positives = 23/51 (45%) Frame = +2 Query: 227 IQSECDPCSQQVRSPVTNIARTSFFHIKRANIWLAAVTKQNVNAAMVFEFL 379 +++EC PCS++ + + + F + IW+ K + A +L Sbjct: 71 LENECSPCSEKQKKIADKVVQ--FLIDNKPEIWVLLEAKYDPTGAYKQHYL 119 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -1 Query: 343 LCDCCQPNICTLDMEERCACNVGN 272 LC CC + C +M C N Sbjct: 746 LCHCCDFDACDCEMTCPAGCKCYN 769 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 270 GDRTCCEHGSHSL*MRPQHYDQYH 199 G+R+C S + + YDQ H Sbjct: 249 GERSCSRDRSREYKKKDRRYDQLH 272 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,793 Number of Sequences: 438 Number of extensions: 4638 Number of successful extensions: 24 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -